KEGG   Acidiphilium cryptum: Acry_1623Help
Entry
Acry_1623         CDS       T00527                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
acr  Acidiphilium cryptum
Pathway
acr00020  Citrate cycle (TCA cycle)
acr00310  Lysine degradation
acr00380  Tryptophan metabolism
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
Module
acr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acry_1623
  Amino acid metabolism
   00310 Lysine degradation
    Acry_1623
   00380 Tryptophan metabolism
    Acry_1623
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Acry_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II COQ9
Motif
Other DBs
NCBI-ProteinID: ABQ30829
UniProt: A5FYZ7
LinkDB All DBs
Position
complement(1791848..1794697)
Genome map
AA seq 949 aa AA seqDB search
MAGVDILATAMNGGNAAFIANLYAKWVEAPDSVDPDFASLFAALGDDARSVLGDAAGASW
APRPISFERPAAPAEAGKGAPLSRQGTIDSIRALMFIRAYRVRGHLEADLDPLGLRQPGH
HPELDPASYGFTEADMDRPIFIDMVLGRETATMREIIAILRESYCGKIGVEFMHIQDPEQ
KSWIQRRVEGAPWRTALDKEGKRRVLTQLTEAEGFETFCQRRYVGTKRFGLEGGESTIPA
LHAIIETAARAGVNEIAIGMPHRGRLNTLVNIVKKPFTAVFSEFGGESFKPDAVQGSGDV
KYHLGTSADLVIAGNKVHLSLQPNPSHLEAVDPVVAGKVRARQDMAGDTRGRRSVMGILM
HGDAAFAGQGLVYETLAMSQLIGYRTGGTVHIVVNNQIGFTTVPAHAYSGLYCTDVAKSV
QSPIFHVNGDDPEAVVFVAQLATEFRQEFGVDVVIDLVCYRRHGHNETDEPAFTQPLMYQ
AIRGRKTTRTLYAERLAAEGAVGTAESDQIHKDFVATLEEAYKAAASYKPNKADWLEGHW
AGLNSARDEEGETEEPTAIPLDTLRRIGNALARVPDDFDVNPKIARQLEAKAEMIRTGEG
IDWATGEALAFGSLLLEGHRVRLSGEDCQRGTFSQRHAVLIDQTSQNEYVPLNNIGEEQS
RIEIFNSLLSEAGVLGFEYGYSLADPRTLVLWEGQFGDFANGAQVIIDQFIAAGESKWLR
MSGLTLLLPHGYEGQGPEHSSARPERFLQLCAENNMAVCNITTPANYFHALRRQLKRNFR
KPLIIMTPKSLLRHKLAVSTLEDMTNGSAFRTVIPETDALVAPEKVRRVVLCSGKVYYDL
VAERRDRGIDDVAIVRVEQLYPFPKKALKTAIEAYVNAEVIWCQEEPENMGYWHFLDRRI
EAALECTATKMAASRPRFAGRKAAASPATGLAKVHAAEQAALVREALGV
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgtggatattcttgcgacggcgatgaatggcggcaacgcggcgttcatcgcc
aacctctatgcgaaatgggtcgaggcgcccgattcggtcgatccggatttcgccagcctg
ttcgccgcgctgggcgacgatgcgcgatcggtgctgggcgatgcggccggcgcctcctgg
gcgccgcgaccgatcagcttcgaacgaccggccgcgccggccgaggcgggcaagggcgcg
ccgctttccagacagggcacgatcgattcgatccgtgccctgatgttcatccgggcctat
cgcgtgcgcggccatctggaggccgatctcgatccgctcggcctgcgccagcccggccac
cacccggaactcgatccggccagctacggcttcaccgaggccgacatggaccggccgatc
ttcatcgacatggtgctgggccgcgagaccgcgacgatgcgcgagatcatcgccatcctg
cgcgagagctattgcggcaagatcggcgtcgagttcatgcacatccaggatcccgagcag
aaatcctggatccagcgccgcgtcgagggcgcgccctggcgcaccgcgctcgacaaggag
ggcaagcgccgcgtcctcacccagctcaccgaggccgagggcttcgagaccttctgccag
cgccgctatgtcggcaccaagcgcttcgggctggagggcggcgaaagcaccatccccgcg
ctgcacgcgatcatcgagacggcggcgcgggccggcgtcaacgagatcgcgatcggcatg
ccgcatcgcggccggctcaacacgctggtcaacatcgtcaagaagccgttcaccgcggtg
ttctccgaattcggcggcgagagcttcaagccggacgcggtgcagggctcgggcgacgtc
aaataccatctcggcacctcggccgacctcgtcatcgccggcaacaaggtgcatctctcg
ctgcagcccaacccctcgcatctcgaggcggtggatcctgtcgtcgccggcaaggtccgc
gcccggcaggacatggcgggcgacacccgcggccgccgctcggtcatgggcatcctgatg
catggcgacgccgccttcgccggccagggcctcgtctatgaaaccctggcgatgagccag
ctgatcggctaccgcaccggcggcacggtccacatcgtggtgaacaaccagatcggcttc
accaccgtgcccgcccacgcctattccggcctctattgcaccgatgtcgccaaatccgtg
cagtcgcccattttccatgtgaacggcgacgatcccgaggcggtggtcttcgtcgcccag
ctcgcgaccgagttccgccaggaattcggcgtcgacgtggtgatcgacctggtctgctac
cgccgccacggccataacgagaccgacgagccggccttcacccagccgctgatgtatcag
gcgatccgcggccgcaagacgacccgcaccctctatgccgagcgcctcgccgccgagggc
gcggtcggcaccgccgagtccgaccagatccacaaggatttcgtcgccacgctggaagag
gcctacaaggccgccgccagctacaagccgaacaaggcggactggctggaaggccactgg
gccggcctcaactccgcgcgcgacgaggagggcgagaccgaggaacccaccgccatcccg
ctggacacgctgcgccggatcggcaacgcgctggcccgcgttcccgacgatttcgacgtc
aaccccaagatcgcccgccagctcgaggccaaggccgagatgatccgcaccggcgagggg
atcgactgggcgaccggcgaggcgctcgccttcggctcgctcctgctcgagggccatcgg
gtccgcctctccggcgaggactgccagcgcggcacgttcagccagcgccacgccgtgctg
atcgaccagaccagccagaacgaatacgtcccgctcaacaatatcggcgaagagcagtcc
cgcatcgagatcttcaactcgctgctctccgaggccggcgtgctcggcttcgaatacggc
tattcgctggccgacccgcgcaccctcgtgctctgggaaggccagttcggcgacttcgcc
aacggcgcgcaggtcatcatcgaccagttcatcgccgccggcgagagcaagtggctgcgc
atgtccggcctgaccctgctgctgccgcacggctatgaagggcaggggccggaacattcc
tcggcccgccccgagcgcttcctgcagctctgcgccgagaacaacatggcggtgtgcaac
atcaccaccccggccaactatttccacgcgctgcgccgccagctgaagcggaacttccgc
aagccgctgatcatcatgacgccgaaatcgctgctgcggcacaagctcgcggtctcgacg
ctggaggacatgaccaacggctcggccttccgcaccgtgatccccgagaccgatgcgctg
gtcgcccccgagaaggtccgccgcgtcgtgctctgctcgggcaaggtctattacgacctg
gtcgccgagcggcgcgaccgcgggatcgacgatgtcgcgatcgtgcgggtcgagcagctc
taccccttcccgaagaaggcgctgaagaccgcgatcgaggcctatgtgaacgccgaggtg
atctggtgccaggaggagcccgagaacatgggctactggcatttccttgaccgccggatc
gaggcggcgctggaatgcaccgcgacgaagatggccgcctcgcgcccgcgcttcgccggc
cgcaaggccgcggcgagcccggcgacggggcttgcgaaggttcacgccgccgaacaggcg
gccctggtcagggaagcgctcggcgtctga

DBGET integrated database retrieval system