KEGG   Acidiphilium cryptum: Acry_1948Help
Entry
Acry_1948         CDS       T00527                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
acr  Acidiphilium cryptum
Brite
KEGG Orthology (KO) [BR:acr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:acr03012]
    Acry_1948
   03029 Mitochondrial biogenesis [BR:acr03029]
    Acry_1948
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acr04147]
    Acry_1948
Translation factors [BR:acr03012]
 Eukaryotic Type
  Elongation factors
   Acry_1948
 Prokaryotic Type
   Acry_1948
Mitochondrial biogenesis [BR:acr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Acry_1948
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Acry_1948
  Exosomal proteins of breast cancer cells
   Acry_1948
  Exosomal proteins of colorectal cancer cells
   Acry_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABQ31149
UniProt: A5FZW7
LinkDB All DBs
Position
complement(2133085..2134272)
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFRAYDSIDAAPEERARG
ITIATAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKMDMADPDLVELVEMEVRDLLSKYEFPGDDIPIIKGSALCALED
SNAELGREAILKLMEAVDSYIPQPERPKDKPFLMPVEDVFSISGRGTVVTGRVERGIIKV
GDEVEIVGLKATVKTTVTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGSI
TPHTNFSGSVYILNKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGVEMVMPGDNVTV
SVELIAPIAMDEGLRFAIREGGRTVGSGVVASITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctaaattcgagcggacgaagccgcactgcaacatcggcacgatcggccac
gtcgatcatggcaagacctcgctcaccgcggcgatcaccaaggtgctggccgaatccggt
ggtgcgaccttccgcgcctatgacagcatcgacgccgctcccgaggagcgcgcccgcggc
atcacgatcgcgaccgcgcatgtcgagtacgagaccgcgaaccgccactacgcgcatgtc
gactgccctggccacgccgactacgtgaagaacatgatcaccggcgcggcgcagatggat
ggcgcgatcctggtcgtctccgccgccgatggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgccggcgctcgtcgtgttcctcaacaagatggacatg
gccgaccccgacctcgtcgagctggtcgagatggaagtccgcgacctgctgagcaagtat
gagttcccgggcgacgacatccccatcatcaagggttccgctctctgcgcgctcgaggac
agcaatgccgagctcggccgcgaggcgatcctgaagctgatggaagcggtggacagctac
atcccgcagccggagcgcccgaaggacaagccgttcctgatgccggtcgaagacgtgttc
tcgatctccggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcatcaaggtt
ggcgacgaagtcgagatcgtcggcctgaaggccaccgtgaagacgacggtcaccggcgtc
gaaatgttccgcaagctgctcgaccagggcgaggccggcgacaacatcggcgcgctgctg
cgtggcaccaagcgtgaagacgtcgagcgtggccaggttctcgccgcgccgggctcgatc
accccgcacaccaacttctccggttcggtctacatcctgaacaaggaagaaggcgggcgc
cacacgccgttcttcaccaactatcgcccgcagttctatttccgcaccaccgacgtgacc
ggcgtggtcacgctgccggaaggtgtcgagatggtgatgccgggtgacaacgtgacggtg
agcgtcgagctgatcgcgcccatcgcgatggacgaaggtctccgcttcgcgatccgcgaa
ggcggccggacggttggttcgggcgtcgtcgcgagcatcacgaagtaa

DBGET integrated database retrieval system