KEGG   Acidiphilium cryptum: Acry_2259Help
Entry
Acry_2259         CDS       T00527                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
acr  Acidiphilium cryptum
Pathway
acr00250  Alanine, aspartate and glutamate metabolism
acr00280  Valine, leucine and isoleucine degradation
acr00410  beta-Alanine metabolism
acr00640  Propanoate metabolism
acr00650  Butanoate metabolism
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acry_2259
   00650 Butanoate metabolism
    Acry_2259
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acry_2259
   00280 Valine, leucine and isoleucine degradation
    Acry_2259
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acry_2259
Enzymes [BR:acr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Acry_2259
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Acry_2259
Amino acid related enzymes [BR:acr01007]
 Aminotransferase (transaminase)
  Class III
   Acry_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABQ31454
UniProt: A5G0S2
LinkDB All DBs
Position
2490981..2492261
Genome map
AA seq 426 aa AA seqDB search
MSTNTDLHARREAAVARGVGISHPMAYTARAENAELWDADGKRYIDFAGGIAVLNTGHRH
PKVIEAVKAQLDRFTHTCFQVTPYEPYVALAERLNAIAPIEGPAKTVFLTTGAEALENAI
KIARAATGRPGVITFAGGYHGRTLLTMAMTGKVIPYKKRFAPMPAEIYHAPFPYEPFGVS
VADSIRGIDMLFRADIEPERVAAIVIEPVQGEGGFIPAPTELLVALREICDRHGILLIVD
EVQTGFGRTGKMFGIEHSGVKPDLMTIAKSLAGGFPLSGVIGRAAVMDAPEPGGLGGTYA
GNPLACAAALAVLDVIRDENLVERANAIGATMKSRLERIASRNDVAPITAIRGPGAMIAF
DIVRQRGSYEPDPDTTKQVIARAREHGLIVISCGVYGNAIRLLVPLTVSDTVLGEGMDAL
EAALAG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaataccgaccttcatgcgcggcgcgaggccgccgtggcccgcggtgtgggc
atcagccacccgatggcctacacggcccgcgccgagaacgccgagctgtgggacgcggac
ggcaagcgctatatcgacttcgccggcgggatcgcggtgctcaacacggggcatcgccat
ccgaaggtgatcgaggcggtgaaggcgcagctcgaccgctttacccatacctgcttccag
gtcacgccgtacgagccttacgtggcgctcgccgaacggctcaacgcgatcgcgccgatc
gaggggccggccaagaccgtgttcctgaccaccggcgccgaggcgttggaaaacgcgatc
aagatcgcccgcgccgccaccggccgccccggcgtgatcaccttcgccggcgggtatcac
ggccgcaccctgctgaccatggcgatgaccggcaaggtcattccctacaagaagcgcttc
gcgccgatgccggccgagatctaccacgcgcccttcccgtacgagcccttcggcgtcagc
gtggccgacagtatccgcggcatcgacatgctgttccgtgccgatatcgagcccgagcgc
gttgccgccatcgtgatcgagcctgtccagggcgagggcgggttcatcccggcgccgacc
gagctgctggtggcgctgcgcgagatctgcgaccgccacggtatcctgctgatcgtcgac
gaggtgcagaccggtttcggccgcaccgggaagatgttcggcatcgagcattcgggcgtc
aagccggacctgatgacgatcgcgaaatccctcgccggcggcttcccgctctccggcgtg
atcggccgcgccgcggtgatggatgcgccggagcccggcggcctcggcggcacctatgcc
ggcaatccgctcgcctgcgccgccgcccttgccgtgctcgacgtcatccgggatgaaaac
ctggtggagcgcgccaatgcgatcggcgccacgatgaagagccggctggaacgcatcgcc
tcgcgcaacgatgtggcgccgatcaccgcgatccgcggtccgggggcgatgatcgccttc
gacatcgtcaggcagcgcggcagctacgagcccgaccccgacactacgaagcaggtcatc
gcgcgcgcccgcgaacacgggctcatcgtgatttcctgcggcgtctatggcaacgccatc
cgcctgctggtgccgctgacggtgagcgacacggttctgggcgaggggatggacgcgctg
gaagccgccctcgccggctga

DBGET integrated database retrieval system