KEGG   Acidiphilium cryptum: Acry_2385Help
Entry
Acry_2385         CDS       T00527                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acr  Acidiphilium cryptum
Pathway
acr00564  Glycerophospholipid metabolism
acr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Acry_2385
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Acry_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABQ31579
UniProt: A5G147
LinkDB All DBs
Position
complement(2624498..2626039)
Genome map
AA seq 513 aa AA seqDB search
MASATDTSVVHDIAIIGGGINGCGIARDAAGRGWSVFLCEAGDLGGATSAASTKLIHGGL
RYLEYYEFRLVREALMEREVLWGIAPHIIWPLRFVLPHHKGLRPAWMLRLGLFLYDHLGG
RKKLPPTRVVRLRRDPAGRPLDPRFVRAYEYSDCWVEDSRLVVLNARDAADRGAVIEPRT
RCISGAREGGLWTLTVRDERSGETRTVRARALVNAAGPWVAEVLQKVLRANTPASVRAVQ
GSHIVVPRLYPEDHCYIFQNADGRIFFVIPYERDFTLIGTTDRDYQGDPAEVRASADEIA
YLCESASAYFTKPVTPADVVWAYSGVRPLYDDGASKAQAATRDYVLEMDAPADGPALLSV
FGGKITTYRRLAESVLGKLAPHLPPATARKQGWTGDEPLPGGDFPTDGFDAQVAALLRDY
PFLAPATAARLVRAYGTRARVLLGDARRAEDLGAIFGADLTEAELRYLHAHEFALTAEDV
VWHRSKFGLRLSDAEIAAVERFMQTLAAQDAHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcaacggacacttcagtggtccacgacatcgcgatcatcggcggtggcatc
aatggctgcggcatcgcgcgcgatgcggcggggcgcggctggtcggtctttctctgcgag
gcgggcgatctcggcggcgccacctcggcggcctcgaccaaattgatccatggcggcctg
cgctatctcgaatattacgagttccggctggtgcgcgaggcgctgatggagcgcgaggtg
ctgtggggcatcgcgccgcacatcatctggccgttgcgcttcgtgctgccgcaccacaag
gggttgcgcccggcctggatgctgcggctcggcctctttctctacgatcatctcggcggg
cggaagaaactgccgccgacgcgcgtggtgcggttgcggcgcgatcccgccggccgcccg
ctcgatccgcgctttgtccgcgcctacgaatattcggattgctgggtggaggattcgcgc
ctcgtcgtgctgaacgcgcgcgatgcggcggatcggggcgcggtgatcgagccgcgcacc
cgctgcatcagcggcgcgcgcgagggcgggctgtggaccctcaccgtgcgcgacgagcgc
agcggcgaaacccgcacggtgcgcgcccgcgccctggtgaacgccgccgggccctgggtc
gccgaggtgctgcagaaggtgctgcgggcgaacacgccggcctcggtgcgcgccgtccag
ggcagccacatcgtcgttccccggctctaccccgaggatcattgctacatcttccagaac
gccgatggccgcatcttcttcgtcatcccctatgagcgggatttcaccctgatcggcacc
accgaccgcgactatcagggcgaccccgccgaggtgcgcgcctcggctgacgagatcgcc
tatctctgcgagtccgccagcgcctatttcacgaagccggtcacgccggcggatgtcgtc
tgggcctattccggcgtccgcccgctctatgacgacggcgcctcgaaagcccaggccgcc
acgcgcgactacgtgctggagatggacgcgccggccgatggccccgccctgctctcggtc
ttcggcggcaagatcacgacctaccgccgcctggccgaatcggtgctcggcaagctcgcg
ccgcacctgccgcccgccaccgcgcggaagcagggctggaccggcgacgagcccctgccc
ggcggcgatttcccgaccgacgggttcgacgcccaggtggcggcgctgttgcgcgactat
ccgttcctcgcgccggccaccgcggcgcggctggtcagggcctatggcacccgcgcgcgc
gtcctgctcggcgatgcgcggcgggcggaggatctcggcgccatcttcggcgccgacctg
accgaggcggaactgcgttacctgcacgcccacgaattcgcgctgaccgcggaggacgtg
gtgtggcaccgcagcaagttcggcctgcggctgagcgatgccgagatcgccgctgtcgag
cggttcatgcagaccctcgccgcacaggacgcccacgcatga

DBGET integrated database retrieval system