KEGG   Acidovorax sp. RAC01: BSY15_1012Help
Entry
BSY15_1012        CDS       T04481                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acra00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BSY15_1012
Enzymes [BR:acra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSY15_1012
Transporters [BR:acra02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSY15_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 Transglut_core2 GST_C
Motif
Other DBs
NCBI-ProteinID: AOG21491
UniProt: A0A1B3PFE8
LinkDB All DBs
Position
1130220..1130864
Genome map
AA seq 214 aa AA seqDB search
MLTLCGFSASNYYNKVKLQLLEKGLPFEERLAWVGETDRTATPLGKVPYLLTPEGPLCES
AVMADYIEALHPEPALLPPGAYGAAKVRELVTFLELHLELVARNLYPQAFFGGTVSESAR
EKVGAQLEKNIAAFGQLTRFDPFIAGSSFTLADCAAIVHLPLVSSATKIVFGRDFLADLP
VRDYLARMGERPHVQRVNADRKANTAEMLARPKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctcacactctgcggcttttctgccagcaactactacaacaaggtcaagctgcaactg
cttgaaaagggtctgccgtttgaggaacggctggcctgggtcggcgagacggaccgcacc
gccacgccgctgggcaaggtgccctacctgcttacccccgaaggcccgctgtgcgagtcg
gccgtgatggccgactacatcgaggccctgcacccggagcctgctctgctgcccccgggt
gcttacggcgccgccaaggtgcgcgaactcgtcaccttcctcgaactgcacctggagctg
gtggcgcgcaacctgtacccgcaggcgtttttcggcggaaccgtcagcgaatccgcacgc
gagaaagtgggcgcgcagctcgaaaagaacattgccgcgtttggccaactgacacgattc
gatccgttcattgccggcagcagcttcacgctggccgactgcgccgccatcgtgcacctg
ccgctggtgagctcggccacgaagatcgtctttggccgggactttctggcggatctgccc
gtgcgcgactacctggcccgcatgggtgaacgcccccacgtgcagcgcgtgaacgccgac
cgcaaggcgaacacggcagagatgctggcgcgtccgaagaagtga

DBGET integrated database retrieval system