KEGG   Acidovorax sp. RAC01: BSY15_1036Help
Entry
BSY15_1036        CDS       T04481                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00564  Glycerophospholipid metabolism
acra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSY15_1036
Enzymes [BR:acra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSY15_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like NAD_binding_8 GIDA 3HCDH_N Pyr_redox_3 Lycopene_cycl Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOG25285
UniProt: A0A1B3PR93
LinkDB All DBs
Position
complement(1144115..1145710)
Genome map
AA seq 531 aa AA seqDB search
MTSATPSPLPTRRVDLLARLAQPVQYDLAVIGGGATGLGVAVDAAARGFSVVLIDSHDFA
KGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLPFVMPSYRFWETP
FYGIGLKMYDALAGKAGLGATEFLGKESTLKCLPTARAEGLKGGVKYWDGQFDDARLALA
LARTAASLGALVVNYCPATALVHDNGKVAGFVCRDAVGGQEFTVRAHAVVNATGVWVDGL
RQMDGEATGRPVTAMVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKLILG
TTDSPRQDVVREPLPFAEEVRFILEESARYLSRAPGVQDIRSIWVGLRPLVKPQDDDGDN
TKSLSREHTVLASRSGLVTVTGGKWTTYRAMAEDVLQKCFTSGLLPEKPAGVTNSLSVVG
APQGKVTHRISDAQGMHSYGSDAPFVQALAGQSSELGGGLTEAMVRFAARYEYACTVEDV
LARRSRMLFLDARKAIELAPAVAAILQDELGTDPALQDFLALAPQYLHVPA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagccacgccttcccccctgcccacacgacgggtcgacctgctcgcccgcctg
gcccagcccgtccagtacgacctggcggtcatcggagggggtgccaccggcctcggggtg
gctgtggacgcggccgcacggggtttttccgtggttctgattgattcgcacgatttcgcc
aagggaacgtcgtcccgcgccaccaagctggtgcacggtggcgtgcgctacctggcccag
ggcaacatcgccctggtgcgcgaggcgctgcacgagcgcaccacgctgctgcacaacgcg
ccgcacctggcgcaaccgctgcctttcgtcatgccgtcctaccgtttctgggagaccccg
ttctacggcatcgggctcaagatgtacgacgccctggccggcaaggcaggcctgggtgcc
accgaatttctcggcaaagaaagcacgctcaagtgcctgcccacggcgcgcgcggagggc
ctcaagggcggcgtgaagtactgggacggccagtttgacgacgcccgcctggcgctggcg
ctggcgcgcacggccgccagcctgggtgccctggtggtgaactattgccctgccaccgcg
ctggtgcacgacaacggcaaggtggctggcttcgtctgccgcgacgcggtgggcggccag
gaattcaccgtgcgggcgcatgcggtggtcaatgccaccggtgtctgggtggatggcctg
cgccagatggacggcgaggccacaggccgccccgtgacggccatggtggcgcccagccag
ggcgtgcacatcgtggttgatcgggaatttttgccgtccgaccacgcgctcatggtgccc
aagacggccgacgggcgcgtgctgttcgcggtgccgtggctgggcaagctcattctgggc
accaccgacagcccccgccaggacgtggtgcgcgagccgctgccgtttgccgaagaagtc
cgcttcatcctggaagaatccgcgcgctacctcagccgggcgccgggcgtgcaggacatc
cgcagcatctgggtcggcctgcgcccgctggtcaagccgcaggacgacgacggcgacaac
accaagagcctgagccgcgagcacacggtgctggccagccggagcggcctggtcaccgtg
acgggcgggaaatggaccacctaccgggccatggccgaagatgtgttgcaaaaatgcttc
acatccggcctgctgccggaaaagccggcgggcgttaccaattcgctgtcggtggtgggt
gcgccacagggaaaggtcacgcaccgcatcagcgacgcacagggcatgcattcgtacggc
agcgatgcgcccttcgtgcaggcgcttgcggggcagtcttcagagctgggcggcggtctg
accgaagccatggtgcgttttgccgcacggtacgaatacgcctgcaccgtggaagacgtg
ctcgcccgcagatcgcgcatgctgtttctggatgcccgcaaggccatcgagctggcccct
gcggtcgcggccatcctgcaggacgaactgggtaccgacccggcgctgcaagactttctg
gcgctcgcaccccagtatctgcacgtgccggcctga

DBGET integrated database retrieval system