KEGG   Acidovorax sp. RAC01: BSY15_1045Help
Entry
BSY15_1045        CDS       T04481                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00330  Arginine and proline metabolism
acra01100  Metabolic pathways
acra01110  Biosynthesis of secondary metabolites
acra01130  Biosynthesis of antibiotics
acra01230  Biosynthesis of amino acids
Module
acra_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSY15_1045 (proC)
Enzymes [BR:acra01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BSY15_1045 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AOG22205
UniProt: A0A1B3PHF3
LinkDB All DBs
Position
1154785..1155621
Genome map
AA seq 278 aa AA seqDB search
MSQTIASSSLPTIAFIGGGNMASAIIGGLIRQGHAAGNIEVVEPYEPTRAALLQSYGITA
QAAPTAALQRAEIVVWAVKPQTFKDAAAQTRAHTQQALHLSVAAGIRSDSIAQWLGSERI
VRTMPNTPALVGLGQSALYARPAVSTAERQSVEAIMASTGEFLWVESEKQLDAVTALSGS
GPAYVFYFLEAMTRAGVGMGLSEQQAHQLAVGTFVGASELARRSDEPPAVLRQRVTSKGG
TTYAALQSMEAAGMGANFEAAMRAAELRAHELGDEFGA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccatcgcctcctccagccttcccaccatcgccttcattggcgggggcaac
atggccagcgccatcattggcggtctgatccggcaggggcatgcggccgggaacatcgag
gtggtcgagccgtacgagcccacgcgtgcggcgctgctgcaaagctatggcatcacggcg
caggcggcacccacagccgcgctgcagcgtgccgaaatcgtggtgtgggccgtcaagccc
cagacgttcaaggacgctgccgcgcagacccgggcgcacacgcagcaggcgctgcacctg
agcgtggcagcaggcatccgttcggacagcatcgcccagtggctgggcagcgagcgcatc
gtgcgcaccatgcccaacacgccagcgctggtgggcttgggacagagcgcgctgtacgcc
cgcccggccgtgagcaccgccgaacgccagagtgtagaagccatcatggcgtccaccggc
gaatttttgtgggtcgagtccgaaaagcagctggacgccgtcacggcgctgtcgggctcg
ggcccggcctatgtgttctattttctggaggccatgacccgcgctggcgtgggcatgggg
ctgagcgagcagcaggcgcaccagttggcggtgggcacctttgtgggcgcgtcagaactg
gcgcgtcgctcggacgagccgccagccgtgctgcgccagcgcgtcacctccaagggcggc
accacctatgccgcgctgcagtccatggaagcggccggcatgggcgccaactttgaggcg
gccatgcgcgccgccgaattgcgggcccacgaactgggcgatgaattcggcgcttga

DBGET integrated database retrieval system