KEGG   Acidovorax sp. RAC01: BSY15_1683Help
Entry
BSY15_1683        CDS       T04481                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00473  D-Alanine metabolism
acra01100  Metabolic pathways
acra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acra00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY15_1683 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BSY15_1683 (alr)
Enzymes [BR:acra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSY15_1683 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:acra01011]
 Precursor biosynthesis
  Racemase
   BSY15_1683 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOG22747
UniProt: A0A1B3PJ30
LinkDB All DBs
Position
1878435..1879550
Genome map
AA seq 371 aa AA seqDB search
MPRPIAATIHTAALHHNLQRVRQSVPDAKVWAVVKANAYGHGIERVFEGLRGADGFALLD
LAEAERVRHLGWRGPILLLEGVFEPRDLELCSRLGLWHAVHCDEQIDMLAAHKTQVPHRV
FLKMNSGMNRLGFTPARYRAAWARLGALPQVDEISVMTHFSDADSPRGIGHQIEAFNAAT
QDLPGERSVSNSAATLRHHTDARLRSDWVRAGIVLYGSAPDFPENSPAHWQVQPTMTLST
RLLAVQHLQPGDTVGYGSRFRATEPLTIGIAACGYADGYPRHCDTGTPVLVGGVRTQLVG
RVSMDMVTVDLTPVLAAGVAAGFGTEVTLWGRASTGAILPIDDVAQAAGTVGYELMCALA
QRVPVVVEGAA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccccattgccgccaccatccacaccgccgccttgcatcacaacctgcagcgg
gtgcgccagtcggtgcccgacgccaaggtgtgggcggtggtcaaggccaatgcctacggc
cacggcatcgagcgcgtgtttgaaggcctgcgcggtgccgacggctttgcgctgctggac
ctggccgaggccgagcgcgtgcgccacctgggctggcgcggccccatcctgctgctggag
ggcgtgttcgagccgcgcgacctggagctgtgctcgcgcctgggcctgtggcacgccgtg
cactgcgacgagcagatcgacatgctggccgcgcacaagacgcaggtgccgcaccgcgtg
tttctcaagatgaactcgggcatgaaccgcctggggttcacgcctgcccgctaccgcgcg
gcctgggcgcggctgggtgcactgccgcaggtcgacgagatctcggtcatgacgcatttc
agcgacgccgacagcccgcgcggcattggccaccagatcgaggccttcaacgccgccacg
caggacctgccgggcgagcgcagcgtgtccaacagcgcggccaccctgcgccaccacacc
gatgcgcgcctgcgctcggactgggtgcgcgcgggcatcgtgctgtacggcagcgcaccc
gactttcctgaaaacagccccgcgcactggcaggtgcagcccaccatgacgctctcgacc
cgcctgctggcggtgcagcatctgcaacccggcgacacggtgggttacggctcgcgcttt
cgtgccaccgagccgctgaccatcggcatcgccgcctgcggctatgccgacggctacccg
cgccactgcgacaccggcacccccgtgctggtgggcggagtgcgcacgcagctggtgggc
cgggtgagcatggacatggtcacggtggacctcacgcccgtgctggctgcgggcgtggcg
gcgggtttcggcaccgaggtcacgctgtggggcagggcctcgaccggggctatcttgccc
atcgatgacgtggcccaggccgctggcaccgtgggttacgagctgatgtgcgcgctggcg
cagcgcgtgccggtggtggtggaaggcgctgcctga

DBGET integrated database retrieval system