KEGG   Acidovorax sp. RAC01: BSY15_1688Help
Entry
BSY15_1688        CDS       T04481                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSY15_1688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acra02000]
    BSY15_1688
Enzymes [BR:acra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSY15_1688
Transporters [BR:acra02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSY15_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C Arabino_trans_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AOG23121
UniProt: A0A1B3PK30
LinkDB All DBs
Position
complement(1884189..1884812)
Genome map
AA seq 207 aa AA seqDB search
MDKLTLYYTPGTCALAVRIALHEAGADHELVRVDFAAGQQRTPEYLAVNPKGRVPALVTS
QGILTETPALLAYVAQSFPQAQLAPADAYGLARMQELHSYLASTVHVAHAHRPRASRWAD
EPDAIAAIQRKVPQNMTDCFDFIEHHYFARADQGPWVMGGQYTVADGYLFTIGTWLEGDG
VDIARFPKVCAHAQRVRERPAVQRALA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcacgctgtactacacccccggcacctgtgcgctggccgttcgcattgcg
ctgcacgaggccggtgccgaccacgagctggtgcgcgtggactttgccgcaggccagcag
cgcacgcccgagtacctggccgtgaaccccaaggggcgggtgccggcgctcgtcacaagc
caaggcatcctcaccgagaccccggcactgctggcctacgtggcgcagagctttccgcag
gcacagctggcgccggccgacgcttacggcctggcacgcatgcaggagttgcacagctac
ctcgcgtccaccgtgcatgtggcccacgcgcaccggccccgcgccagccgctgggccgac
gagcccgacgccatcgcggccatccagcgcaaggtgccgcagaacatgaccgactgcttt
gatttcatcgaacaccactactttgcccgcgcggatcagggcccgtgggtgatgggcggg
cagtacaccgtggccgatggctacctgttcaccatcggcacctggctggagggcgatggc
gtggacattgcccggttcccgaaggtgtgtgcgcacgcgcagcgggtgcgggagcggcca
gcggtgcagcgcgcgctggcctga

DBGET integrated database retrieval system