KEGG   Acidovorax sp. RAC01: BSY15_1753Help
Entry
BSY15_1753        CDS       T04481                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00550  Peptidoglycan biosynthesis
acra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSY15_1753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acra01002]
    BSY15_1753
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acra01011]
    BSY15_1753
Enzymes [BR:acra01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSY15_1753
Peptidases [BR:acra01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BSY15_1753
Peptidoglycan biosynthesis and degradation proteins [BR:acra01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BSY15_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 BenE
Motif
Other DBs
NCBI-ProteinID: AOG24608
UniProt: A0A1B3PPE2
LinkDB All DBs
Position
1954684..1955853
Genome map
AA seq 389 aa AA seqDB search
MKRILSALRSLAVFAAVAPAAFGVHAQAPQPPEIAARTYMLVDVTANQVLAAKDIDAPVE
QASLTKLMTGYLVFDALRAKKIALDQKLPVSVRAWKMPGSRMFIDPKMQVPVEDLIKGMI
VQSGNDATVALAEGVGGTYENFVKLMNDQAKALGMNGTSYKNPEGLTEPGHLTTARDLSV
LATRLMKDFPEYMHYYATKQYSYPGTPASNGGNRNSLLFRDPTVDGLKTGHTAAAGYCLV
ATSKRDFPGVGQRRLLSIVLGAASENARANESQKLLNWGYTAFEAVKLFDAGQAVSTPAV
WKGTENTLKIGRPEAIVVTVPAGSAGKIKTEIARPDPLVAPFIKGQPVGTLKVVLGDQAL
AEVPLVALDAVAQAGIMGRAWDAIRLWIK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcctgtctgcgctgcgatcccttgctgtctttgctgccgtggccccggcc
gccttcggcgtgcatgcccaggcgccccagccccccgagattgccgcccgcacctacatg
ctggtcgatgtgaccgccaaccaggtcctggccgccaaggacatcgatgccccggtcgag
caggcttcgctcaccaagctcatgacgggctatctggtgtttgacgccctgcgcgccaag
aaaatcgccctcgaccagaagcttcccgtgagcgtgcgcgcctggaagatgcctggctcg
cgcatgttcatcgaccccaagatgcaggtgccggtggaggacctcatcaagggcatgatc
gtgcagtcgggcaacgacgccaccgtggcgctggccgaaggcgtaggcggcacgtacgag
aacttcgtcaagctcatgaacgaccaggccaaggccctgggcatgaacggcaccagctac
aagaaccccgaaggcctcacggaacccggccacctgaccacggcgcgggacctgagcgtg
ctggccacgcggctgatgaaggactttccggagtacatgcactactacgctaccaagcag
tacagctaccccggcaccccggcgtccaacggcggcaaccgcaactcgctgctgttccgc
gaccccacggtggacggcctcaagaccggccacacggccgccgccggctattgcctggtg
gccacgtccaagcgggacttccccggcgtgggccagcgccgcctgctgtccatcgtcctg
ggtgctgccagcgaaaacgcgcgcgccaacgaaagccagaagctcctgaactggggctac
accgcgttcgaggccgtcaagctgtttgacgccggccaggccgtatcgacccccgccgtg
tggaagggcaccgaaaacacgctcaagatcggtcgccccgaagccatcgtggtcaccgtg
cccgccggcagcgccggcaagatcaagaccgaaatcgcccgccccgacccgctggtggcg
ccgttcatcaagggccagccggtgggcacgctcaaggtggtgctgggcgatcaggccctg
gccgaagtgcctctggtggcgctcgatgccgtcgcgcaggcgggcatcatgggccgcgcc
tgggatgcgatccgtctgtggatcaaatag

DBGET integrated database retrieval system