KEGG   Acidovorax sp. RAC01: BSY15_2156Help
Entry
BSY15_2156        CDS       T04481                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00473  D-Alanine metabolism
acra00550  Peptidoglycan biosynthesis
acra01100  Metabolic pathways
acra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY15_2156
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSY15_2156
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSY15_2156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acra01011]
    BSY15_2156
Enzymes [BR:acra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSY15_2156
Peptidoglycan biosynthesis and degradation proteins [BR:acra01011]
 Precursor biosynthesis
  Amino acid ligase
   BSY15_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp TTL CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AOG23985
UniProt: A0A1B3PMJ4
LinkDB All DBs
Position
2393039..2394028
Genome map
AA seq 329 aa AA seqDB search
MTLPESKIDVKALGKVAVLMGGESAEREVSLMSGSGVLQALRTSGVDAHAFDPATHALSD
LRRDGYARCFIALHGRHGEDGTVQGALELLGIPYTGPGVMASAIAMDKVMTKRVWLAEGL
PTPRYVWLAPDRQQPEIVRKVPDELGLPLIVKPPREGSSIGVTKVRGPSDMQAAVELSAR
YDADVLCEEFIDGEEVTCPVLGHGAQARALPVIRIVAPDGAYDYQNKYFTDDVKYQCPSG
LPEAEEREIQRIVLEAYRTLGCRGWGRADLMIRASDRKPFLLEMNTSPGMTGHSLVPMSA
RASGISYEELCLRILADAALDTPARPKAA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccttccagaatccaaaattgacgtcaaggccctgggcaaggtggccgtgctgatg
ggcggcgaatcggccgagcgcgaggtgtcgctcatgtccggcagcggggtgctgcaggcc
ctgcgcaccagcggcgtggacgcccatgcgttcgaccctgccacccatgcgctgagcgac
ctccggcgcgatggctatgcgcgctgcttcatcgcgctgcacggccgccatggcgaagac
ggcaccgtgcagggcgcgctggagctgctgggcattccgtacaccggcccgggcgtgatg
gcatcggccatcgccatggacaaggtcatgaccaagcgtgtgtggctggcagaaggcctg
cccacgccgcgctacgtgtggctggccccagaccgccagcaacccgagatcgtccgcaag
gtgcccgatgaactgggcctgccgctgatcgtcaagccgccgcgcgagggctcgtccatc
ggcgtgaccaaggtgcgcggcccgtccgacatgcaggccgcagtggagctgtctgccagg
tacgacgctgatgtgctgtgcgaagagttcattgacggcgaggaagtgacctgccccgtg
ctgggccatggcgcccaggcgcgcgcgctgccggtgatccgcatcgtggcgcccgacggt
gcttacgactaccagaacaagtatttcaccgacgacgtgaagtaccagtgcccgagcggc
ctgcccgaagcagaggaacgcgagatccagcgcatcgtgctggaggcctaccgcacgctg
ggctgccgcggctggggccgcgccgacctgatgatccgcgccagcgaccgcaagcccttc
ctgctggagatgaatacgtcgccgggcatgacgggccactcgctggtgcccatgtcggcg
cgtgcgtcgggcatcagctacgaggaactgtgcctgcgcatcctggcggacgcagccctc
gacacgcccgcaaggccaaaggctgcttga

DBGET integrated database retrieval system