KEGG   Acidovorax sp. RAC01: BSY15_2781Help
Entry
BSY15_2781        CDS       T04481                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acra  Acidovorax sp. RAC01
Brite
KEGG Orthology (KO) [BR:acra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY15_2781 (ahpF)
Enzymes [BR:acra01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSY15_2781 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like Glutaredoxin FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AOG24548
UniProt: A0A1B3PP53
LinkDB All DBs
Position
3096567..3098183
Genome map
AA seq 538 aa AA seqDB search
MLDDQLKSQLSAYLERVQQPFELVASLDDSETARDMRELLETIQSLRTDKITLRTDGTDA
RKPSFSLQRVGATNSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDSIKALDGDFN
FEVYMSLTCHNCPDVVQALSLMAIVNPKVKTTVIEGGAFQQEVTDREIMAVPMVFLNGQV
FGSGRMTIEEIVAKLDTGSAAREAAKLSAKDPYDVLIVGGGPAGAAAAVYAARKGIRVGV
AAERFGGQVNDTLAIENYISVQETDGPKFAAALEAQTRSYGVDIMNLQRADKIIPAAQPG
GLTEVVLANGGSLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGVVAHVTLIEFADQLKADAVLVNKLKSLSNVTIHTNAQTTEITGA
DGKVNGLKYKDRATNVEHLVPLEGVFVQIGLVPNTEWLKGTVELSKFGEIVVDAKGHTNV
PGVFAAGDCTTVPYKQIVIAAGDGSKAALSAFDHLIRQPALPAASAAAPAAERVAEPA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaccaactcaaatcgcaactctctgcctacctcgaacgcgtgcagcagcca
tttgaactggtggcttccctggacgacagcgagactgcgcgcgacatgcgcgagctgctg
gaaaccatccagtccctgcgcaccgacaagatcacgctgcgcaccgacggcaccgatgcg
cgcaaaccatcgttcagcctgcagcgcgtgggcgccaccaacagcctgcgttttgccggg
ctgcccctgggccacgagttcacctcgctggtgctggcgctgctgtggacgggcggccac
ccgcccaaggtcgagcaggacgtgatcgactccatcaaggccctggacggtgacttcaat
ttcgaggtctacatgagcctgacctgccacaactgcccggacgtggtgcaggcgctgtcg
ctcatggccatcgtcaatcccaaggtcaagacgaccgtgatcgaaggcggcgccttccag
caggaagtgaccgaccgcgaaatcatggccgtgcccatggtgttcctcaacggccaggtg
ttcggctcgggccgcatgaccatcgaggaaatcgtggccaagctcgacaccggctctgcc
gcccgcgaagccgccaagctgtctgccaaggacccgtatgacgtgctcatcgtgggtggt
ggccccgcaggcgctgcagccgccgtgtatgccgcccgcaagggtatccgcgtgggtgtg
gcggccgagcgctttggcggccaggtcaacgacacgctggccatcgagaactacatctcg
gtgcaggaaaccgacggccccaagtttgctgccgcactggaggcgcagacccgctcgtac
ggcgtggacatcatgaacctgcagcgcgctgacaagatcatccccgcggcccagcccggc
ggcctgaccgaagtggtgctggccaacggcggctcgctcaaggccaagacggtgatcctg
tcgaccggcgcccgctggcgcaatgtgaacgtgcccggcgaagccgagtacaagaacaag
ggcgtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcacggccgtg
atcggcggcggcaactcgggtgtcgaggcggccatcgacctggcaggcgtggtggcccac
gtcacgctgattgaatttgccgaccagctcaaggccgacgcggtgctggtcaacaagctc
aagagcctgtccaacgtgaccatccacaccaacgcgcagaccaccgagatcaccggcgcc
gacggcaaggtcaacggcctcaagtacaaggaccgcgccaccaacgtggaacacctggtg
ccgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcaagggc
acggtggagctgagcaagtttggcgagatcgtggtggatgccaagggccacaccaacgtg
ccgggcgtgtttgcggccggcgactgcaccacggtgccgtacaagcagatcgtgattgca
gcgggcgacggttcgaaggcggcgctgagcgcgttcgaccacctcatccgccagccggca
ctgcctgcggcttcggcagccgcgcccgctgcagagcgggtggctgaacccgcctga

DBGET integrated database retrieval system