KEGG   Acidovorax sp. RAC01: BSY15_4005Help
Entry
BSY15_4005        CDS       T04481                                 

Definition
(GenBank) ATP dependent DNA ligase domain protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra03030  DNA replication
acra03410  Base excision repair
acra03420  Nucleotide excision repair
acra03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acra00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSY15_4005
   03410 Base excision repair
    BSY15_4005
   03420 Nucleotide excision repair
    BSY15_4005
   03430 Mismatch repair
    BSY15_4005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acra03032]
    BSY15_4005
   03400 DNA repair and recombination proteins [BR:acra03400]
    BSY15_4005
Enzymes [BR:acra01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSY15_4005
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSY15_4005
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSY15_4005
DNA replication proteins [BR:acra03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSY15_4005
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSY15_4005
DNA repair and recombination proteins [BR:acra03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSY15_4005
   NER (nucleotide excision repair)
    Other NER factors
     BSY15_4005
   MMR (mismatch exicision repair)
    Other MMR factors
     BSY15_4005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AOG21609
UniProt: A0A1B3PFU0
LinkDB All DBs
Position
4412747..4413727
Genome map
AA seq 326 aa AA seqDB search
MPDSYQFYSIHPFSGFSTTLTHGEGMAAPKPRRVTGTTPLEPLARRRWLGWLLGTGLLLP
ATGIAADAPALLLAHVYRPGTPLADYWVSEKYDGVRGFWDGQTLRTRGGETVVAPAWFTA
GWPAEPMDGELWAGRGQFTHAQSTTRQQQPDDAAWRQMRFMVFDLPRHGGTFDERLPALN
RMVEGIGQPWVQAVPQRKVATDAALQALLQRTVRAGGEGLMLHRGASLYRAGRNDDLLKL
KTHEDTEAKVVAHLPGTGKHAGRMGALLVEMPSGQRFRLGTGFSDAERNTPPPVGSWVTY
RYRGTHDGGLPRFASFVRVRDDMPPR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccagacagctatcaattttatagtattcacccgttttctggcttcagtacaacgctg
acgcacggcgagggaatggcggctccaaagcccaggcgcgttaccggtaccactcccctg
gagccactcgcgcgccgtcgctggctgggttggctgctcggcacgggtctgctgctaccc
gccacaggcatcgccgccgatgcgcccgccctgctgctggcacatgtctaccgccccggc
acaccgctggccgattactgggtgagcgaaaaatacgatggggtgcgcggcttctgggac
ggccagacgctgcgcacgcgcggcggcgaaaccgtggtggcacccgcctggttcaccgca
ggatggcccgccgagcccatggacggcgaactgtgggccggccgaggccaattcacccat
gcccagtccaccacacgccagcagcaaccggacgatgccgcgtggcgccagatgcgcttc
atggtgtttgacctgccccgccatggcggtacgttcgatgaacgattgcctgcgctgaac
cgcatggtcgagggcatcgggcagccgtgggtgcaggcggttccgcagcgcaaggtggcg
accgacgccgcactgcaggccctgctgcaacgcactgtgcgcgcaggcggcgaggggctg
atgctgcaccgtggcgcatcgctgtaccgcgcgggccgcaacgatgacctgctcaagctc
aagacccacgaagacaccgaggcgaaggtggtggcccacctgcccgggacgggcaagcat
gccggccgcatgggggcgctgctggtcgagatgccgtctggccagcgctttcggttgggc
acggggttcagcgatgccgaacgcaacacaccgccacccgtgggcagctgggtcacgtac
cgctaccggggcacgcacgatggcggactgccccgttttgccagctttgtccgcgtgcgg
gacgacatgccgccgcgctga

DBGET integrated database retrieval system