KEGG   Arthrobacter crystallopoietes: AC20117_00965Help
Entry
AC20117_00965     CDS       T05322                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00564  Glycerophospholipid metabolism
acry01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AC20117_00965
Enzymes [BR:acry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AC20117_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUI49591
UniProt: A0A1H1F7X2
LinkDB All DBs
Position
complement(208634..210358)
Genome map
AA seq 574 aa AA seqDB search
MSSGAMSPENREEALAALRATQDHDRELDILIVGGGVVGAGAALDAVTRGLDVGIVEARD
WSSGTSSRSSKLIHGGLRYLEMLDFALVREALQERGLLLQRIAPHLVRPVPFLYPLTKRF
VERPYVGAGVALYDALSVASGHGRGVPFHKHLSRHGTLRAAPSLKKDAFVGSIRYYDAQV
DDARLVVNLVRTAAEYGAHAANRLKVINFLREGERVVGARVRNQEDGTEFDIRAKQVVNA
TGVWTDETQAMVTERGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVLFVIPWGRHWI
IGTTDTSWDLDKAHPAASSKDIDYLLEHVNQVLSRPLTREDVEGVYAGLRPLLAGENDDT
AKLSREHVVAHPVPGLVVVAGGKYTTYRVMARDAVDEAARALDERVPPSCTEIVPLLGAS
GFKAKWNKRSRMADRAGIHVARVEHLLNRYGSMTDEVLDIITGSPELAEPLPGADDYLQA
EIVYATTHEGARHIDDVLTRRTRISIEAWDRGVSAAPVVAALMAPLLNWSGEQEAREVKH
YLARVEAERLSQEQPDDITADSARMGVDDIVPLS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggagccatgagtcctgaaaaccgtgaggaggccctggccgccctgcgggcc
acgcaggaccacgaccgggagctggacatactgattgtcggcgggggagtggtcggcgcc
ggcgctgcgctggacgccgtcacccgcggcctcgatgtcggcattgtggaggcccgggac
tggtcctccggcacgtcctcccggtcctccaagctcatccacggcgggcttcgctacctg
gagatgctggactttgccttggtccgtgaagccctccaggaacgcggcctgctgctgcag
cgcatcgcgccgcacctggtccgcccggttcctttcctctatccgctgaccaaacggttc
gtcgagcgcccctacgttggtgccggcgtcgcgctgtacgacgcgctgtcggtggccagc
ggccacggccgcggggtgcccttccacaagcacctgtcgcggcacggcaccctgcgggcg
gcgccgagcctgaagaaggatgccttcgttggttccatccgttattacgacgcgcaggtc
gacgatgcgcggttggtggtcaaccttgtccggacggctgcggagtacggggcgcatgcc
gccaaccggctgaaggtcatcaacttcctgcgcgagggcgaacgtgtggtcggcgcgcgc
gtccgcaaccaggaagacggcaccgagttcgacatccgggccaaacaggtggtcaacgcc
acaggggtctggaccgatgagacccaggccatggtcaccgagcgcggccagctgaaagtg
cgggcctcgaagggcatccacctggtggtgccccgggaccgcttccagtccaccgtgggg
ctgatcctgcggaccgaaaagtcggtgctgttcgtcatcccgtggggccggcattggatc
atcggcaccacggataccagctgggacctggacaaggcccaccccgcggcgtcgtcgaag
gacatcgactatctgctcgagcacgtcaaccaggtgctcagccgcccgctgacccgcgag
gatgtggagggcgtttacgccggactccggccgctgctggcgggcgagaacgacgacacg
gccaagctctcgcgcgaacacgtggtcgcgcatcccgttcccgggctggtggtggtggcg
ggcggcaagtacaccacgtatcgggtcatggccagggatgcggtggacgaagcagcgcgt
gccctggacgagcgcgtgccgccgagctgcaccgagattgttccgctgctcggagcctcc
gggttcaaggcgaagtggaacaagcgcagccgcatggccgaccgtgcgggaatccatgtg
gcccgggtggagcacctgctcaaccggtacgggtccatgacggatgaagtgctggacatc
atcaccggcagccccgagctggccgagccgctgccgggcgcggacgactatctgcaggcc
gaaatcgtctacgccaccacgcatgagggcgcccgccatatcgacgacgtactcacccgg
cgtacccggatctccatcgaggcctgggaccgcggtgtctcagccgcccccgtggtagcg
gccctcatggcgccgctgctgaactggagcggcgagcaggaagcgcgggaagtcaagcac
taccttgcgcgggtggaagccgaacggctcagccaggaacagcctgacgatatcaccgcc
gacagcgcgcgcatgggtgtggacgacattgttccactcagctga

DBGET integrated database retrieval system