KEGG   Arthrobacter crystallopoietes: AC20117_01760Help
Entry
AC20117_01760     CDS       T05322                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00010  Glycolysis / Gluconeogenesis
acry00030  Pentose phosphate pathway
acry00051  Fructose and mannose metabolism
acry00052  Galactose metabolism
acry00680  Methane metabolism
acry01100  Metabolic pathways
acry01110  Biosynthesis of secondary metabolites
acry01120  Microbial metabolism in diverse environments
acry01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AC20117_01760
   00030 Pentose phosphate pathway
    AC20117_01760
   00051 Fructose and mannose metabolism
    AC20117_01760
   00052 Galactose metabolism
    AC20117_01760
  09102 Energy metabolism
   00680 Methane metabolism
    AC20117_01760
Enzymes [BR:acry01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AC20117_01760
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AC20117_01760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AUI49733
LinkDB All DBs
Position
372250..373278
Genome map
AA seq 342 aa AA seqDB search
MKIGIMTSGGDCPGLNAVIRGVVLKGIKSHDHEFVGFLDGWRGVVDGDIIELPRQRVRGI
SKQGGTILGTSRTNPYDGPNGGPENIAATLDRLDVDALIAIGGEGTLAGARELTDAGLPI
VGVPKTIDNDLDATDYSFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALH
AGMASGAHAILIPEQKVSTAQVAEWVREAHDRGRAPLVVVAEGWVPEGDAEPWAERGTDA
SGRPRLGGIGEHLAPEIEALTGIETRAATLGHIQRGGVPSAYDRVLATRLGMAAVDAVSD
KRWGTMVSLHGTDVVVVPFEEALGNLKTVPQHRYDEAAVLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcggcatcatgaccagcggtggcgactgccccggcctgaacgcggtgatccgc
ggcgttgtgctcaaaggcatcaagtcccatgaccacgagtttgtcggcttcctcgatggc
tggcggggcgtcgtcgacggggacattatcgaactgccccgccagcgcgtgcgcggcatt
tccaaacagggcggaaccatcctcggtacctcccgcaccaatccctacgacggacccaac
ggcggtccggagaacattgcggccacgctggaccgcctggatgtggatgcgctcatcgcc
atcggcggggaagggaccttggcgggcgctcgtgaactgacggacgcgggcctgccgatt
gtcggagtgccgaaaaccatcgacaatgaccttgacgccacggactactcgtttggtttc
gatacagccgtccagatcgccaccgaggccatcgaccggctgcgcaccaccggtgaatcg
caccaccggtgcatgatcgccgaggtcatgggccgccacgtcggttggattgccctgcac
gccgggatggcttccggcgcccatgccatcctcattccggagcagaaggtgagcaccgcc
caggtcgccgagtgggtccgcgaggctcacgaccgcggccgtgcccccttggtagtggtg
gccgaaggctgggttccggagggcgacgccgagccctgggccgaacgcggcacggacgct
tccggccgtccccggctgggcggcatcggtgaacacctcgcgccggaaatcgaggccctg
accggcatcgaaacccgggccgcgaccttgggccatatccagcgcggcggcgttccctcg
gcctatgaccgcgtcctggccacccggctcggcatggctgccgtcgacgccgtttcggac
aaacgctggggaaccatggtctccctgcacggcaccgacgtcgtcgttgttccgttcgaa
gaggcgctcggaaacctgaagaccgtgccgcagcaccgctacgacgaggcggcagttctc
tttggctga

DBGET integrated database retrieval system