KEGG   Arthrobacter crystallopoietes: AC20117_03705Help
Entry
AC20117_03705     CDS       T05322                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
acry  Arthrobacter crystallopoietes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUI50054
UniProt: A0A1H1E4C1
LinkDB All DBs
Position
complement(765771..766847)
Genome map
AA seq 358 aa AA seqDB search
MKLPVMPPVAPMLAKPLSEIPDGDMSFEPKWDGFRSIIFRDGDDVEIGSRNEKPMNRYFP
EIIEAVKKNLPERCVVDGEIVLVGASGDRLDFEALQQRIHPAASRVKLLAEQTPAKFVAF
DLLALGDEDLTGEPFAERRARLAKALAHAQPPIHLTNATADHGVAVRWFHEFEGAGLDGV
IAKPLDGLYQPNKRAMFKIKHERTVDCVLAGYRVHKSGPDRIGSLLLGLYNDDGELANVG
VAGSFSMQRRQELFEELQPLVTTFDDHPWAWAKQEEGTRTPRNSEGSRWSGGKDLSFTPL
RPERVVEVKYDHMEGERFRHTTQFARWRPDRDPRSCTYEQLEEPVKFNLDEVLNPGNG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttccggtaatgcccccggtcgccccgatgctggcgaagcccctcagcgagatt
cccgacggcgacatgagcttcgaacccaaatgggacgggttcagatcgatcatcttccgc
gacggggacgacgtcgaaatcggcagccgcaacgaaaagccgatgaaccgctactttccc
gaaatcatcgaagcggtcaagaagaacctgccggaacggtgcgtggtcgacggcgaaatc
gtcctggtcggagcttcgggggaccggctggacttcgaggccctgcagcagcggatccat
cccgcggccagccgggtgaagcttctcgccgagcagacgccggccaagttcgtcgccttc
gacctgctggccctgggcgatgaggacctgaccggcgagccctttgccgagcggcgtgcc
cgcctggcaaaggccctcgcccacgcgcagccgccgatccatctgacgaatgccacggcg
gaccacggcgtggccgtgcgctggttccatgagtttgaaggcgccgggctcgacggcgtg
atcgccaagccgctggacggcctgtaccagccgaacaagcgggcaatgttcaagatcaaa
cacgagcgcacggtggactgcgtgctcgctggctaccgggtgcacaaaagcggcccggac
cggatcggctccctgctgctcgggctctataacgacgacggtgaactcgccaatgtgggc
gtggccggttcgttttcgatgcagcggcgccaggagctgttcgaggaactgcagccgctg
gttactaccttcgatgaccatccgtgggcgtgggcgaagcaagaagagggcacccggacc
ccgcgcaattccgaaggcagccggtggagcgggggcaaggacctgtcttttacgccgctg
cgcccggagcgcgtggtcgaagtgaagtatgaccacatggagggcgaacggttccgccac
accacccagttcgcccgctggcggccggaccgggatccccggtcctgcacctacgagcag
ctggaagaaccggtgaagttcaacctggatgaagtactcaatcccgggaacggctga

DBGET integrated database retrieval system