KEGG   Arthrobacter crystallopoietes: AC20117_07560Help
Entry
AC20117_07560     CDS       T05322                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acry00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AC20117_07560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acry03400]
    AC20117_07560
Enzymes [BR:acry01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AC20117_07560
DNA repair and recombination proteins [BR:acry03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AC20117_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AUI50700
UniProt: A0A1H1CK97
LinkDB All DBs
Position
1591863..1594406
Genome map
AA seq 847 aa AA seqDB search
MAQTSSSQRQLVTVDGHRLKLTSLDKVIYPETGTIKAEVLDYYSRIAEYLIPHAAHRPVT
RKRWVNGVGTADKPGEVFFQKNLEEHAPSWVKSHAIEHKSGTNVYPMVNDLATLTWLAQI
SALEIHVPQWKFGPRGKMNNPDRLVLDLDPGEGAGLAECAEVARLVRAVLTGMGLDPRPV
TSGSKGIHLYAALDGKQTSEEVSAVAHELARVLEADHKDLVVSDMKKTLRRGKVLLDWSQ
NHWNKTTITPYSLRGRAHPMVAAPRTWEELDDPDLAHLDFLQVLERVGELGDLLEGMGSG
TADEESLAEAMEEAGEQAGEDQTNNDGGARRGGPAHGSDRFTKYRSMRDPAKTAEPVPEA
PPVDRGGNTFVIQEHHARRLHYDFRLEREGVLVSWAVPKGPPTSPGKNHLAVQTEDHPLE
YGSFEGTIAKGEYGAGEVYIWDSGTYDLEKWRDGKEVIVTLHGKEGGGLSKDGGPEAPRR
YALIHTGGEKGENNWLMHLMKDQKPGTYRKGTPHERQGDDLAKEVEPAFIKPMLATQGSA
ADITAEHQWAFEMKWDGIRAIAIIEDRGVRLISRNGNDLTAGYPELADLPDRVHAETAVL
DGEIVALNKAGRPDFGLLQTRMKLTKKREIDQAAARTPVHLMLFDLLQLDGKSLLALEYC
QRREILAQAVDAGGDGHVQVPPDLDTSLQEAVDTSKELGLEGVMAKRVDSTYADGQRSRS
WIKIKNQLTQEVVIVGWRPGKGSRERKIGSLLVAIPDGADLRYLGRVGSGLTERDLAAVG
ARLKKMARKTPPLDDVPAADASDAHWVRPALVGEVQFSERTEAGKLRHPVWRGFRPDKKP
SDVVVEV
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacaagctccagccagcgccagctggtcacggtggacggacaccggctgaag
ctgacgagcctggacaaggtgatttaccccgaaaccgggaccatcaaggccgaagtgctg
gactattactcgcggatcgccgagtacctcattccgcatgccgcgcaccggccggtcacc
cgcaagcgctgggtcaacggggtgggcacggcggacaaacccggggaggtgttcttccag
aagaacctggaggaacacgccccgtcctgggtcaagagccacgcgatcgagcacaagagc
gggaccaatgtgtacccgatggtcaacgatctggccacgctcacctggctggcgcagatc
tcggcgctggagatccacgtgccgcagtggaagttcgggccgcggggcaagatgaacaat
ccggaccggctggtactggacctggacccgggggagggcgccggcctggccgaatgcgcc
gaggtggcacggctggtccgggccgtgctgaccgggatggggctggatccgcggccggtc
accagcggctccaagggcatccatctgtacgccgcgctggacggaaagcagacctcggag
gaggtgtccgccgtcgcgcacgaactggcgcgcgtgctggaggcggaccacaaggatctg
gtggtcagcgacatgaaaaagacgctgcgccggggcaaggtcctgctggactggagccag
aaccactggaacaagaccaccatcaccccctattcgctgcgcggccgcgcccatccgatg
gtggccgcgccgcgcacctgggaggaactcgacgacccggacctggcgcacctggacttt
ctgcaggtgctggagcgcgtcggcgagctcggggacctgctcgagggcatgggttccggg
accgcggacgaggaatcgctggccgaggccatggaggaagccggggagcaggcaggggag
gaccagacaaacaacgacggcggtgcgcgccgcggcgggccggcgcacggttccgaccgg
ttcaccaagtaccggtccatgcgcgacccggccaaaacggccgagcccgtccccgaggct
ccgccggtggaccgcggcggcaacacgtttgtgatccaggagcaccacgcccggcggctg
cactacgatttccggctggagcgcgaaggggtgctggtgtcgtgggccgtgccgaagggg
ccgcccaccagcccgggcaagaaccatctggccgtccagaccgaggaccacccgctggaa
tacggcagcttcgaaggcaccatcgccaagggcgagtacggcgcgggcgaggtctacatc
tgggactcgggcacctatgacctggagaagtggcgggacggcaaagaggtcatcgtcacc
ctgcacggcaaggagggcggcgggctcagcaaggacggcggacccgaggcgccgcggcgc
tacgccctgatccacaccggcggggaaaagggcgagaacaactggctgatgcacctgatg
aaggaccagaagccggggacctaccggaagggcacgccgcacgagcgccaaggcgatgac
ctggccaaggaggtggagccggcgttcatcaagcccatgctggcaacgcagggctccgcc
gcggacatcaccgctgaacaccagtgggcgttcgagatgaagtgggacggcatccgcgcc
atcgccatcatcgaggaccgtggcgtgcggctgatcagccgcaacggcaacgaccttacc
gccggctacccggaactggcggacctgccggaccgggtgcacgcggaaacggccgtgctg
gacggggaaatcgtggcccttaacaaggccggccgcccggacttcggtctcctgcaaacc
cggatgaagctgaccaagaagcgcgagatcgaccaggccgcagcgcggaccccggtccac
ctgatgctcttcgacctgctgcagctcgacggcaaatcgctgctggcgctggaatactgc
cagcgccgcgagatactggcacaggccgtggatgccggcggcgacggccacgtccaggtg
ccgccggaccttgacacctcgctgcaggaagccgtggacaccagcaaggaactcggcctt
gaaggtgtgatggccaaacgggtagacagtacatacgcggacggacagcgctcaaggagt
tggatcaagatcaagaaccagttgacgcaggaagtggtcatcgtgggctggcgtcccggc
aagggcagccgggaacgcaagatcggctcgctgctggtggccattccggacggcgcggac
ctgcgttacctgggccgcgtcggctccggcctgaccgagcgggacctggcggccgtgggc
gcgcgcctgaagaagatggcccgcaagaccccgccgctggacgacgttcccgccgcggac
gcctcggacgcgcattgggtccggccggccctggtaggcgaggtgcagttcagcgaacgg
accgaggccggcaagctccgccaccccgtctggcgcggcttccggccggataagaaaccg
tccgacgtcgtggtcgaggtctga

DBGET integrated database retrieval system