KEGG   Arthrobacter crystallopoietes: AC20117_09770Help
Entry
AC20117_09770     CDS       T05322                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
acry  Arthrobacter crystallopoietes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUI51062
UniProt: A0A1H1BQ65
LinkDB All DBs
Position
2061965..2062975
Genome map
AA seq 336 aa AA seqDB search
MSDRLPPELRPPLDVALARSVPSIPKPDALPGGCLFEPKWDGYRLLIGRDGDATSLQSRQ
GKDLTRYFPDLVAAAQEQLPPGCLLDGEAVIWSQDRLDFSLLQQRLSASARSLLRQVQDK
PAHFVAFDLLAVAGHDIRREPLHDRRALLEELAKEWSGPLELSPVTADPEIAAGWFRDLP
ATGVEGLVIKGTGQSYDGGQRQWLKVKHRETLDVVCAAVIGPMARPQAIVAGLPIDGELR
IVGRSVPLKPAAAKLLGSRLQPPAGEHPWPHRVKSTAMDRFNASGGETELTLIEPIVVEV
SADTSWSGRSFRHPLRYVRYRPELDPDEVSAPFGNP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaccgcctgccgccggagctgcggccaccgctggatgtggcgttggcccgtagc
gtcccatcgatcccgaaaccggatgccctgcccggcggttgcctctttgaacccaaatgg
gacggctaccggctcctcatcggccgggacggtgatgccacgtccttgcagtcccgccag
ggcaaggacctcacccgctacttcccggatttggtggcagctgcccaggagcaactgcca
ccaggatgtctgctggacggcgaggcggtgatctggtcgcaggaccggctggacttctcg
ctgttgcagcagcgactgagtgcctccgcccgttccttgttgcgtcaggtgcaggacaag
cccgcgcacttcgtcgccttcgatcttctcgccgtggctggccatgatattcgacgggag
ccgctgcacgaccgccgcgcactgcttgaggagctggccaaggaatggtccggcccgttg
gagttgtccccggtaaccgccgatccggaaatagccgccggctggttccgggatttgccg
gcaaccggcgtcgaaggcctggtgatcaaaggcaccggtcaaagttacgacggcggccag
cgccagtggctcaaggtcaagcacagggaaacactggacgtcgtctgcgcagccgtcatc
ggtccgatggccaggccacaggcaattgtcgccggcctgcccatcgatggtgagctgcgg
atagtggggcggtctgttccgctcaagccggcggcggccaagcttctggggtcgcggctg
cagccgccggccggggagcatccgtggccgcaccgcgtgaagtccaccgccatggaccgg
ttcaacgcaagcgggggagagacggaacttaccctcatcgagcccatcgtcgtcgaggtt
tccgccgatacgtcctggtcagggcggtcatttcggcaccctctgcgctacgtgcgttac
cgtcccgagctggatccggatgaggtctcagctcccttcggtaacccctga

DBGET integrated database retrieval system