KEGG   Arthrobacter crystallopoietes: AC20117_09935Help
Entry
AC20117_09935     CDS       T05322                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00620  Pyruvate metabolism
acry00680  Methane metabolism
acry01100  Metabolic pathways
acry01120  Microbial metabolism in diverse environments
acry01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acry00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AC20117_09935
  Energy metabolism
   00680 Methane metabolism
    AC20117_09935
Enzymes [BR:acry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AC20117_09935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUI51089
UniProt: A0A1H1BMS1
LinkDB All DBs
Position
2094735..2097524
Genome map
AA seq 929 aa AA seqDB search
MPEGDLDARLRADVRRVSTLLGQSLVRQHGPELLDLVEQVRLLTKESKEAARGGGEASGP
WTARDVADQVRELLAGLPTVQATQLVRAFAFYFHLANAAEQVHRVRTLRTRPEQDGWLAK
AVADVAAKAGPAMLQEAVDALDVRPVFTAHPTEASRRSVLDKLRKLSDVLAVRTAEDSVA
RRRQDRMLAEIIDQMWQTDELRQVRPSPVDEARNALYYLDNIFRGAVPELLAELEELLDG
HGAALSAERSPLRFGSWIGGDRDGNPNVTADVTREILALQNQHAVRIGIEQVDELISVLS
NSTALAEAEPELLESIQQDLEKLPGLDKRVLVLNAQEPYRLKLTCIKAKLMNTSARVRNG
TAHQPGRDYASAAEVLDELGLLERSLRAHGASLAADGALARVRRIMSAVGLNLATLDVRE
HAERHHAVVGVLIDRLGELPGCYADLERAERQAVLSKELASRRPLAPVPAPLAGEEAKTY
AVFGEIQRALETYGSNVVETYIVSMTRGPDDVLAAAVLAREAGLLRLHGGDAFARIGFAP
LLETVEELRRSGRILDGLLSDPQYREIVRLRGDVQEVMLGYSDSNKESGVLTSLWEIHQT
QRVLRDVAAKHGVRLRLFHGRGGSVGRGGGPTYDAILAQPNGVLEGEIKFTEQGEVISDK
YSLQPLARENLELSLAAVLEGSALHREPRTSAGERHRYGKVMATVSDASFRCYRELIEDP
DLPEYFFTSTPVEQLGSLKIGSRPSMRPDSGAGLEGLRAIPWVFGWTQSRQIVPGWYGVG
SGLKAAREAGHGEVLQEMADRWHFFQTVVSNVEMTLVKTDLDIAAHYVATLVPARLQHLF
DRIREEFELTVSEVRRLTGEVRLLDNQPVLKKSLEVRDQYLDPISYMQVELLRRLRANGT
SGGGAPDESLQRAMLITVNGVAAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggcgatctcgatgccaggctgcgtgcggacgtccggcgggtcagcacgctg
ctgggccaatcgctggtgcgccagcacggcccggagctgttggatctggtggagcaggta
cggctgctgacgaaagagtcgaaagaagcggcccgcgggggcggggaggccagcgggcca
tggacagcccgggacgtggcggaccaagtgcgtgaattgctcgcggggctgcctaccgtc
caggcgacgcagctggtgcgcgccttcgccttctacttccatttggccaatgcagccgag
caggtccaccgcgtccggaccctgcggacccggccggaacaggacggctggctggccaag
gcggtggcggacgtggccgcgaaggctggtccggcaatgctgcaggaggccgtggacgcg
ctggatgtgcggccggtcttcacagcgcatcctactgaggcatcgcgccgttctgtgctg
gataagctgcgcaagctctccgatgtgctggcggtgcggaccgccgaggacagcgtggcc
agacggcggcaggaccgcatgctggcggaaatcatcgaccagatgtggcagacggacgag
ctgcggcaagtgcggcccagcccggtggacgaggcccgcaacgcgctctactacctcgac
aacattttccgcggcgcggtgccggaactgctggccgaactcgaggaactgctggacggc
cacggcgccgcactgtcggccgagcgctcgccgctgcggttcggcagttggatcggcggc
gaccgggacggcaacccgaacgtcaccgccgacgtgacgcgggagatcctcgccctgcag
aaccagcacgccgtgcggatcgggatcgagcaggtggacgagctgatctcggtgctctcc
aactccacggcgctcgccgaagcggagccggagctgctggaatcgattcagcaggacctg
gaaaagctgcccgggctggataagcgcgtgctcgtgctgaacgcgcaggagccgtaccgc
ctgaaactgacctgcatcaaggcgaaattgatgaacacttccgcccgcgtgcggaacggg
accgcccaccagcccgggcgggactacgcctccgctgcagaagtgctggacgagctgggg
ctgctggaacgatcgctgcgcgcccacggggcctcgctggcggcggatggagcgctggcg
cgggtgcggcggatcatgtccgccgtcggcctgaacctggccacgctggatgtccgcgag
catgccgagcggcaccacgccgtcgtcggtgtgttgatcgaccggctgggcgaactcccc
ggatgttatgcggacctggagcgggcggagcgccaggcggtgctgtcgaaggagctggct
tcacgccggccgctggcgccggtgccggctccgctggcaggcgaggaagccaagacgtac
gcggtgttcggcgaaatccagcgggcgctggagacctacggttcgaacgtggtggagacc
tacattgtgtcgatgacccgcggacccgacgacgtgctggccgccgcggtgctggcgcgg
gaagccggcctgctgcggctgcacggcggggacgcgtttgcgcgcatcggcttcgcgccg
ctgctggaaaccgtggaggagctacgccggtccgggcggattctggatgggctgctatcg
gatccgcagtaccgggagattgtccggctccgcggcgacgtgcaggaagtcatgctcggg
tactcggattcgaacaaggaatccggtgtgctgaccagcctctgggaaatccaccagaca
cagcgggtcctgcgcgacgtcgctgccaagcatggggtccggctgcggctcttccacggc
cggggtggctccgtggggcgcggcggcgggccaacctacgacgccatcctggcccagccg
aacggagtgctggaaggcgaaatcaagttcaccgaacagggcgaagtcatttcggacaag
tactcgctccagccgctggcacgggagaacctggaactgtcgctggcagccgtgctggaa
ggctctgcgctgcaccgggagccgcgcacctccgccggcgagcgccatcgctacggcaaa
gtgatggcaaccgtctccgatgcgtccttccgctgctatcgggagctgattgaagatccg
gacctgccggagtatttcttcacctcgacgccggtggagcagctgggttcgctgaagatc
ggctcgcgaccttcaatgcggccggattcaggggccggtctagaaggtctgcgcgccatc
ccgtgggttttcggctggacgcagtcccggcagatcgtgcccggctggtacggcgtcggt
tccgggctgaaggcggcgcgggaggcgggccatggggaggtgctgcaggagatggcggac
cggtggcactttttccagaccgtggtctccaatgtggaaatgaccttggtcaagacggac
ctggacatcgccgcgcactatgtagccacgctggtgccggcccggctgcagcacctgttc
gaccggatccgcgaagagttcgagctcacggtgtccgaggtccggcgcctcaccggcgaa
gtgcggctgctggacaaccagccggtgctcaaaaagtcgttggaagtgcgggaccagtac
ctggatccgatctcctacatgcaggtggaactgctgcgcaggctgcgcgcgaacgggacc
tcgggcggcggcgcaccggatgaaagcctgcagcgggccatgctgatcacggtcaacggc
gtggcggctggcctgcgcaacaccggctaa

DBGET integrated database retrieval system