KEGG   Arthrobacter crystallopoietes: AC20117_13690Help
Entry
AC20117_13690     CDS       T05322                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00020  Citrate cycle (TCA cycle)
acry00190  Oxidative phosphorylation
acry00650  Butanoate metabolism
acry01100  Metabolic pathways
acry01110  Biosynthesis of secondary metabolites
acry01120  Microbial metabolism in diverse environments
acry01130  Biosynthesis of antibiotics
acry01200  Carbon metabolism
Module
acry_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acry_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acry_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC20117_13690
   00650 Butanoate metabolism
    AC20117_13690
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC20117_13690
Enzymes [BR:acry01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC20117_13690
    1.3.5.4  fumarate reductase (quinol)
     AC20117_13690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_16 Fer4_15 Fer4_2 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AUI51698
UniProt: A0A1H1A390
LinkDB All DBs
Position
complement(2902224..2903012)
Genome map
AA seq 262 aa AA seqDB search
MSTPTEIPEGPSKVELAPGVGGGGEIPSFDITLKVRRYDPEVSEEARWDEFVLTMYGTDR
VLDALHKAKWEHDGSVSFRRSCAHGVCGSDAMRINGRNRLACKTLLKDLDTSKPILVEPI
KGLPVEKDLIVDMEPFFQSYREIMPFLINSGHEPTRERLQSAEDRERFDDTTKCILCAAC
TSSCPVFWTDGQYFGPAAIVNAHRFIFDSRDDAGDMRLEILNDKEGVWRCRTVFNCTEAC
PRGIQVTKAIAEVKNAVLNRKI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgaccgaaattcccgaaggaccgtcaaaggtcgagctggcccccggggtc
ggcggcggaggggaaatcccgagcttcgacatcacgctgaaggttcgccggtacgatccc
gaggtttcggaagaagcccgctgggacgagttcgttctcaccatgtacggaacggaccgc
gtgctggacgccctgcacaaggccaagtgggagcacgacggctcggtttccttccgccgt
tcctgcgcccacggcgtctgcggctccgatgccatgcgcatcaacggccgcaaccgcctg
gcctgcaagacgctgctgaaggacctggacacgtccaagcccatcctcgtcgagccgatc
aagggcctgccggtggagaaggacctgatcgtggacatggagccgttcttccagtcctac
cgcgagatcatgccgttcctgatcaactcgggccacgagccgacgcgtgagcgcctgcag
tccgccgaggaccgcgagcgtttcgacgacaccaccaagtgcatcctgtgcgctgcgtgc
acctcgtcctgccctgtcttctggaccgacggccagtacttcggcccggccgctatcgtc
aacgcgcaccgcttcatcttcgactcgcgagacgacgccggcgacatgcgcctggagatc
ctcaacgacaaggaaggcgtgtggcgctgccgcaccgtcttcaactgcaccgaggcctgc
ccgcgcggcatccaggtgacgaaggcgatcgccgaggtcaagaacgccgtgctgaaccgc
aagatctga

DBGET integrated database retrieval system