KEGG   Arthrobacter crystallopoietes: AC20117_13695Help
Entry
AC20117_13695     CDS       T05322                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00020  Citrate cycle (TCA cycle)
acry00190  Oxidative phosphorylation
acry00650  Butanoate metabolism
acry01100  Metabolic pathways
acry01110  Biosynthesis of secondary metabolites
acry01120  Microbial metabolism in diverse environments
acry01130  Biosynthesis of antibiotics
acry01200  Carbon metabolism
Module
acry_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acry_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acry_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC20117_13695
   00650 Butanoate metabolism
    AC20117_13695
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC20117_13695
Enzymes [BR:acry01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC20117_13695
    1.3.5.4  fumarate reductase (quinol)
     AC20117_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like Thi4 Pyr_redox_2 DAO FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AUI51699
UniProt: A0A1H1A372
LinkDB All DBs
Position
complement(2903012..2904799)
Genome map
AA seq 595 aa AA seqDB search
MQVHKYDVVIVGAGGAGMRAAIESGQRARTAVLTKLYPTRSHTGAAQGGMCAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEVMAKEAIDAVLDLEKMGLPFNRTPEGKIDQRRFGGHT
RDHGKSPVRRACYAADRTGHMILQTLYQNCVKHNVEFYNEYYVLDLLLVEEEALREDGTS
YMQKRVAGVVSYDLASGEIHVFQAKSVVFASGGVGKVFKTTSNAHTLTGDGMGIAFRRGI
PLEDMEFFQFHPTGLAGLGILLSEAARGEGGILRNADGERFMERYAPTIKDLAPRDIVAR
SMANEVREGRGCGPNKDYVLLDLTHLEPAHIDAKLPDITEFARTYLGVEPYTEPVPVFPT
AHYAMGGIPTNIKAEVLQDNDTVVPGLYAAGEVACVSVHGSNRLGTNSLLDINVFGKRAG
IAAAEYAKVAEYVEVPENADQFTIDLIEQVRAANGTERVAQLRKELQDTMDANVQVFRTE
QTLNETLNVIASLRERYKNIGIQDRGRRFNLDLLEAVELGFLLDMAQVMTVAALHREESR
GGHFREDFPDRNDEKFMKHSMAYKDDLATSESVAGIRLETKPVVFTRYEPMVRKY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccataagtacgacgtcgttattgtcggtgccggtggcgccggtatgcgcgcc
gccattgaatcaggccagcgcgcgcgaacagcagtactgaccaagctttaccccacccgt
tcccacaccggtgcggcccagggcggcatgtgcgctgcgctggcgaacgtggaggaagac
aactgggagtggcacacctttgacacggtcaagggcggcgactacctggtagaccaggac
gccgccgaggtcatggcgaaggaagccatcgacgccgtgctggacctggaaaagatgggc
ctgcccttcaaccgcacgcccgaaggcaagatcgaccagcgccgcttcggcggacacaca
cgcgatcacggcaagtccccggtgcgccgcgcctgctacgccgccgaccgtaccggccac
atgatcctgcagacgctgtaccaaaactgcgtcaagcacaacgttgagttctacaacgag
tactacgttctggatctgctcctggtcgaggaggaagcactccgcgaagacggtacctcc
tacatgcagaagcgcgttgccggcgtcgttagctatgacctcgccagcggcgagatccac
gttttccaggctaagtccgtggtcttcgcctccggcggcgtgggcaaggtcttcaagacc
acctcgaatgcccacaccctgaccggtgacggcatgggcatcgcgttccgccgcggcatc
cctctggaagacatggagttcttccagttccacccgaccggcctggccggcctgggcatc
ctgctctccgaagccgcgcgcggcgaaggcggcatcctgcgcaacgccgacggcgaacgc
ttcatggagcgctatgccccgacgattaaggaccttgcgccccgcgatatcgtggcccgt
tccatggccaacgaggtccgcgagggccgcggctgcggcccgaacaaggactacgtcctg
ctggacctcacccacctggagccggcacacatcgacgccaagctcccggacatcaccgag
ttcgcgcgcacctacctgggcgtggagccgtacaccgagccggtgccggtgttcccgacc
gcgcactacgcgatgggcggcatcccgaccaacatcaaggccgaggtgctgcaggacaac
gacacggttgtccccggcctctacgccgccggcgaggtagcctgcgtctccgtccatggc
tccaaccgcctgggcaccaactcgctgctggacatcaacgtcttcggcaagcgcgccggt
atcgccgccgccgagtacgccaaggtagcggagtacgtggaggttccggaaaacgccgat
cagttcacgatcgatctgatcgaacaggtccgtgcggccaacggcaccgaacgcgttgcc
cagctgcgcaaggaactgcaggacaccatggacgccaacgtccaggtcttccgcaccgag
cagaccctgaacgaaacactgaatgtgatcgcgtccctgcgtgagcgctacaagaacatc
ggcatccaggaccgcggccgccgcttcaacctggacctgctcgaagccgtggaactgggc
ttcctgctggacatggcccaggtcatgaccgttgccgccctgcaccgcgaggaatcccgc
ggtggccacttccgggaagacttcccggaccgcaatgacgaaaagttcatgaagcactcc
atggcatacaaggatgacttggccacgtccgagtctgtcgccggtatccgtctggaaacg
aagccggttgtattcacgcgctacgaaccgatggtgaggaagtactaa

DBGET integrated database retrieval system