KEGG   Arthrobacter crystallopoietes: AC20117_15840
Entry
AC20117_15840     CDS       T05322                                 

Definition
(GenBank) hypothetical protein
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acry00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AC20117_15840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acry01001]
    AC20117_15840
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acry02022]
    AC20117_15840
Enzymes [BR:acry01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AC20117_15840
Protein kinases [BR:acry01001]
 Histidine kinases
  OmpR family
   AC20117_15840
Two-component system [BR:acry02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   AC20117_15840
SSDB
Motif
Pfam: HATPase_c HisKA PAS_4 DUF1874 PAS_10 HATPase_c_2 SesA PMC2NT
Other DBs
NCBI-ProteinID: AUI52035
UniProt: A0A1H0ZDF4
LinkDB
Position
complement(3380611..3382329)
AA seq 572 aa
MSAVVKNALAMIGVRKQFHELNLRYRVFLSQMPLVICVALVALVAAIFFPTTLDNVAFQA
GLIMLAILTAASFLVPWDRLPYPTYWVIPLLDFVVVAALRTGGAESLSGLSMLAVFPVFW
LAWSGIAPVTARIISFFAPLLLVWVPVLTSGEPVTAAGLADPFLIPIIMLAICVTASIFS
LSETDKQGVLEAKDRELQAVLDETRDRSRLMQTMMDTVGVGLVAVDKDGHDILMNRRQLQ
NHMLAAPPGNNDPNERQLHVYKPDRTSPIPPEERPVLRAVRGETFSDELVWIGEGKQQRA
MSISARSMRDDDGTFAGSVVAFSDVTDLVNALAAKDDFVASVSHELRTPLTSIIGYLDLA
LEETQLKDPDGSMAVCLSVALRNAERLLQLVSDLLTTASGPAKIEQRSADLAEVIASCLA
SATPRAEEAGVVLVNESPDDLEAFIDHDRMCQVMDNLLSNAIKYSPAGGRVTVSAWRAEG
SVGFEVEDHGMGIAEEDRGGVFTKFFRTPTVRRAAIPGVGLGLVITKAIVEAHGGTIDFT
SELGKGTTFRVLLPAHGGDPVRPTEAASADRI
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtccgcagtcgtcaaaaacgcgctggccatgatcggcgtgcggaagcagtttcatgag
ctgaatctgcggtaccgcgtcttcctgagccagatgccgctggtgatttgcgtggccctg
gtggcgttggtggcggcaatcttcttcccgaccacccttgacaacgtcgctttccaggcg
gggctaatcatgctggcaattctgacggcagccagctttctggtcccctgggatcgtttg
ccctaccccacctactgggtcatcccactgctggatttcgttgtcgtggcagcgctgagg
acaggcggggcggagtcgctgagcgggctgagcatgctggcggttttcccggtgttctgg
ttggcatggtccggcattgcgccagttaccgccagaatcatcagcttcttcgcacccttg
ctgctggtctgggtaccagtcctgacctccggtgaaccggtcactgcagccgggctggcc
gatcctttcctgattcccatcatcatgctcgccatctgcgttacggcgtcgatattcagc
ctgagcgagacggacaaacagggagttcttgaagccaaagaccgcgaactacaggctgtt
ctggatgaaaccagggaccgctccaggctcatgcagacgatgatggacacggtcggcgtc
ggcctggtcgccgtggacaaggacggacacgacatcctgatgaaccggcgccagctgcag
aaccacatgctggccgctcccccgggaaataatgaccccaacgaacgccagctgcacgtg
tataaaccggaccgcacctcgcccatcccgccggaggaacggccggtactgagggccgtg
cgcggggagaccttctccgacgaattggtctggatcggcgagggcaagcagcaacgggcc
atgtccatctccgccagatccatgcgggacgacgacggcaccttcgccggttctgtagtt
gccttcagcgatgtcacggatctggtgaacgccctggctgccaaagacgatttcgtggcc
agcgtgtcgcacgagctgcgcacaccgctgacctcaatcatcggctacctcgatctggcg
ctggaagaaacccagctgaaggatccggacggatccatggccgtatgcctgagcgtggcg
ctgcgcaatgcagagcggctgctccagctcgtctcggaccttctcactaccgcctccggc
cccgccaagatcgagcaacgcagcgctgatctggccgaggtcatcgcctcctgcctggcc
tcggcaacgccccgggcggaggaagccggcgtcgtgctggtaaatgaaagccccgacgat
ctcgaggcattcattgaccatgaccgcatgtgccaggtgatggacaatctgctctccaat
gccatcaagtactcccccgccggcggccgcgtaaccgtcagtgcgtggcgggcagagggc
agcgtcggcttcgaggtggaggaccacggcatgggcattgcggaagaagaccggggcggg
gtcttcaccaaattcttccgcactcccacggtccgccgcgcagccatccccggagttggc
cttggcctggtgatcaccaaggcgatcgtggaagcgcacggcggcacaatcgacttcacc
agcgagctcggcaagggcaccacattcagggtcctgcttccggcccacggcggtgacccg
gtccgtcccacggaggcggcgtcggcggacaggatttga

DBGET integrated database retrieval system