KEGG   Arthrobacter crystallopoietes: AC20117_17240Help
Entry
AC20117_17240     CDS       T05322                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acry  Arthrobacter crystallopoietes
Brite
KEGG Orthology (KO) [BR:acry00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acry01001]
    AC20117_17240
Enzymes [BR:acry01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AC20117_17240
Protein kinases [BR:acry01001]
 Serine/threonine kinases: Other
  Bacterial family
   AC20117_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AUI53530
LinkDB All DBs
Position
complement(3717339..3719369)
Genome map
AA seq 676 aa AA seqDB search
MVGATVDGRYLILSRLARGGMSTVYLATDTRLDRHVALKIMYPHLAEDTSFLERFVREAK
SAAKLSHPHVVGVLDQGFDGQVAYLVMEYVPGHTLRDVLNDKGALTPRLALALLDPVIEG
LAAAHEADLVHRDVKPENVLMSSDGRIKIGDFGLARAVSTTSNTGTLIGTVAYLAPELVT
GAPADARSDIYSAGIMLFEMLTGRQPFTGEVPIHVAFQHVNSTVPAPSTLVPGLAADLDE
LVLWCTSSDPEQRPVDAGALLGELRHIRTTLSDADLDSPKTGSSGTAPTPREQSPPNSAG
PPTEVIGQDENRTTVIAPSYQHTQALTRPQAAVKAGNGYGQASDSSDASDGATPLTKREA
KARDKELSRQARRPEQSLRSHPRRRGLLWAIVLGILAVLVATAGWFFGLGPGAPVEIPGV
SGKPVSDAQSILQDQGLNFRIEEAFNEELEAGVAIGTDPPAPEQIRRFETLTLLVSKGPQ
LFPVPSVTGMTVEQAQAELARANLAAGDVTEAFDEKVPSGEVIGQQPAAEEQLRRNTPVD
LTVSKGPEPFAVPDVTGLTRDEATAALENAGLTVEFAPEAQFHRNIPEGSIAAQNPEQGN
VIRGDTVTLTLSKGPRMVNVPNLVGQQADDARRQLEELGFEVEINEILGGFFGTVRRQDP
VDQSVPEGSVITLTVV
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgcaacagtggacgggcggtacctgattctttcgcgcctcgcgcgtggcggc
atgtccactgtctatctggccaccgatacccgcctggaccggcatgtggcgctgaaaatc
atgtatccgcatttggccgaggacaccagtttcctggaacgcttcgtccgcgaagccaag
tccgccgcaaagctctcgcacccccacgtggtcggcgtcctggaccaggggttcgacggc
caggttgcctacctggtgatggaatatgtccctggccatacgttgcgcgatgtcctcaat
gacaagggtgccttgactccacggctggccctggcattgctggatccggtcatcgagggg
ctcgcggccgcacatgaagcggaccttgtccaccgcgatgtgaaacccgagaacgtgttg
atgtcctccgacggccggatcaagatcggcgacttcgggctcgcccgtgcggtgtccacc
acctcgaacacggggacgctgatcggcaccgtagcgtatctggcgcccgaactcgtgacg
ggggcgcccgcggatgcacgcagcgacatctattcggcagggatcatgctcttcgagatg
ctcaccggcaggcagccctttaccggcgaggttcccattcatgtcgccttccagcatgtg
aactccaccgtgcccgcaccgtccacgctggtgcccggcctagccgcggatcttgatgaa
ctggtgctgtggtgcacttcgtccgaccccgaacagcgtccggtcgatgccggcgccctc
ctcggcgagctgcgacatatccgcaccacgctaagcgacgcggatctcgactcgccgaag
acaggttcgtccggcactgcacccacgccgcgtgaacagagcccacccaactcggcaggc
ccgcctaccgaagtcatcggtcaggacgaaaaccggaccacagtgattgcaccgtcctac
caacacacacaggcactgacccggcctcaggctgcggtgaaagccggaaacggctacggg
caagcgtcggattcttccgatgcatccgatggggcaacaccgctgacgaaacgcgaggct
aaagcccgcgacaaggagttgtcccggcaggcacggcgacccgagcaatcactgcgcagt
catccccgcagacggggtttgctctgggccatcgtgctgggaatcctcgcggtacttgtc
gcgaccgccggttggttcttcggcctgggtccgggagcaccagtggaaattccgggagtc
tcgggcaagcctgtcagcgatgcccaatccatcctgcaggatcagggtctgaacttccgg
atcgaggaagccttcaacgaggagctcgaagccggtgtggcgatcggaaccgatccaccg
gcgccggagcagatccggcggtttgaaacgctgactctgctcgtttccaagggtccccag
ctatttcccgtaccgtccgtcaccggaatgaccgtcgaacaggcgcaggctgaactggcc
agagcgaatctggccgccggcgatgtcaccgaagcctttgacgaaaaggttccatccggc
gaggttatcggccagcagcctgcggccgaggagcagctgcgccgaaacaccccggtggat
ctgacggtgtccaaaggaccagagccgtttgctgtccccgatgtcaccggcttgactcgg
gacgaggctaccgccgctctggagaatgccggcttgactgtcgaatttgctccggaggct
caattccatcggaacattcccgaggggagcattgccgcgcagaacccggaacaaggcaat
gtcatccgtggcgataccgtgacgctgacgctgtcaaagggcccgcggatggttaacgtt
cccaatctcgttggccagcaggcagacgatgcccggcggcagctcgaggagctgggtttc
gaggtcgagattaatgagatcttgggcgggttcttcggcaccgtccggaggcaagatccc
gtggaccagtccgtgcccgaaggctccgtcatcacgctgaccgtagtctaa

DBGET integrated database retrieval system