KEGG   Anolis carolinensis (green anole): 100337530Help
Entry
100337530         CDS       T01608                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase 1, soluble
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00240  Pyrimidine metabolism
acs00983  Drug metabolism - other enzymes
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100337530 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100337530 (tk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100337530 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 100337530
NCBI-ProteinID: NP_001278322
Ensembl: ENSACAG00000016730
UniProt: C3VAL3 G1KT08
LinkDB All DBs
Position
2
AA seq 233 aa AA seqDB search
MNCLMMPGVQPGSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCLLIKYAKDTR
YCVNGVSTHDRNTMEAVSACCLKDVHQEALSSAVIGIDEGQFFPDIIEFCEAMANAGKTV
IVAALDGTFQRKAFGNILHLVPLAESVVKLNAVCMECFREASYTKRLGAEKEVEVIGGAD
KYHSVCRVCYFKKRPQQPTENKENLPSGHKQLEPTASRKVLGICQNMQWGPSN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcttgatgatgccaggggtgcagccgggatcgcctcgcaaggcccggggccag
atccaggtcatctttggacccatgttctccgggaaaagtactgaactcatgcgtcgagtc
cgacgtttccagattgcgcagtacaagtgcctgttgatcaagtacgcaaaggacacacgc
tactgtgtcaacggagtttccacgcatgacaggaacaccatggaagctgtatctgcttgt
tgcctgaaagatgtgcatcaggaagctctcagctctgctgtgattggcattgacgaaggc
cagttttttccagatatcattgagttctgtgaggcaatggccaacgcagggaagactgtc
attgtggcagcccttgatgggacattccagaggaaggcatttggcaacattttgcaccta
gttcccttagcagaaagtgtggtgaaactgaatgctgtctgcatggagtgttttcgtgag
gcatcatatacaaaaaggctgggagcagagaaggaggtggaagtaataggaggagcagac
aagtatcattctgtctgtcgcgtctgctacttcaagaaacgaccacagcagccaacagag
aacaaagagaacctaccaagtggccataagcagttggagcctactgcttcccggaaagtc
ctgggtatttgtcagaacatgcagtggggcccctcaaattga

DBGET integrated database retrieval system