KEGG   Anolis carolinensis (green anole): 100337533
Entry
100337533         CDS       T01608                                 

Gene name
actb
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04145  Phagosome
acs04210  Apoptosis
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100337533 (actb)
  09143 Cell growth and death
   04210 Apoptosis
    100337533 (actb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100337533 (actb)
   04520 Adherens junction
    100337533 (actb)
   04530 Tight junction
    100337533 (actb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100337533 (actb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100337533 (actb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acs03021]
    100337533 (actb)
   03019 Messenger RNA biogenesis [BR:acs03019]
    100337533 (actb)
   03036 Chromosome and associated proteins [BR:acs03036]
    100337533 (actb)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100337533 (actb)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100337533 (actb)
   04147 Exosome [BR:acs04147]
    100337533 (actb)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100337533 (actb)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100337533 (actb)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100337533 (actb)
    NuA4 complex
     100337533 (actb)
  Chromatin remodeling factors
   BAF complex
    100337533 (actb)
   PBAF complex
    100337533 (actb)
   SWR1 complex
    100337533 (actb)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100337533 (actb)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100337533 (actb)
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100337533 (actb)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100337533
NCBI-ProteinID: XP_008122082
Ensembl: ENSACAG00000001200
LinkDB
Position
Un
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatatcgctgcgctcgtggttgacaacggctccggaatgtgcaaggctggc
tttgccggggatgatgcccctcgcgccgtgttcccgtccatcgtcggccgccccaggcac
cagggcgtgatggtcggcatgggccagaaagacagctacgttggggacgaggcgcagagt
aaaagaggcatcctgaccctgaagtatcccatcgaacacggcatcgtcaccaactgggac
gacatggaaaagatctggcaccacaccttctacaacgagttgagagtcgcccctgaagaa
caccccgtgctgctgacagaggcccccttgaaccccaaagccaacagagaaaagatgaca
cagatcatgtttgagaccttcaacacccccgccatgtacgtggccatccaggccgtgctg
tccctgtacgcctctggccgcaccaccggcattgtgatggactctggcgacggcgtcacc
cacaccgtgcccatctacgaaggttacgccctgccccacgccatcctccgcttggacctg
gctggccgcgacttgaccgactacctcatgaagatcttgaccgagagaggctacagcttc
accaccacggccgagagggaaatcgtccgcgacatcaaggagaagctctgctacgtcgcg
ctcgacttcgagcaggagatggccaccgcggcttccagctcctccctggaaaagagctac
gaactccctgacgggcaggtgatcaccatcggcaacgagcggttcaggtgcccggaggcc
ctcttccagccatcctttttgggtatggagtcctgcggtatccatgaaaccaccttcaac
tccatcatgaagtgcgacgtggacatccgcaaagacctgtacgccaacaccgtcctgtct
ggcggcaccaccatgtacccaggcatcgctgacaggatgcagaaggagatcacagccctg
gctcccagcacaatgaaaatcaagatcattgccccaccggagcgtaaatactccgtctgg
atcggaggctccatccttgcctccctgtcgaccttccagcagatgtggatcagcaagcaa
gagtacgacgaatccggaccttccatcgtccaccgcaaatgcttctaa

KEGG   Anolis carolinensis (green anole): 100564373
Entry
100564373         CDS       T01608                                 

Gene name
actg1
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04145  Phagosome
acs04210  Apoptosis
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100564373 (actg1)
  09143 Cell growth and death
   04210 Apoptosis
    100564373 (actg1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100564373 (actg1)
   04520 Adherens junction
    100564373 (actg1)
   04530 Tight junction
    100564373 (actg1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100564373 (actg1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100564373 (actg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acs03021]
    100564373 (actg1)
   03019 Messenger RNA biogenesis [BR:acs03019]
    100564373 (actg1)
   03036 Chromosome and associated proteins [BR:acs03036]
    100564373 (actg1)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100564373 (actg1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100564373 (actg1)
   04147 Exosome [BR:acs04147]
    100564373 (actg1)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100564373 (actg1)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100564373 (actg1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100564373 (actg1)
    NuA4 complex
     100564373 (actg1)
  Chromatin remodeling factors
   BAF complex
    100564373 (actg1)
   PBAF complex
    100564373 (actg1)
   SWR1 complex
    100564373 (actg1)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100564373 (actg1)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100564373 (actg1)
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100564373 (actg1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100564373
NCBI-ProteinID: XP_008102340
Ensembl: ENSACAG00000015238
LinkDB
Position
2
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaattgcagcacttgtcattgacaatggatctggtatgtgcaaagcaggc
ttcgctggagatgatgctcctcgtgctgtgtttccctcaattgttgggcgccctcgccac
cagggtgtcatggttggtatgggccagaaagatagctatgtaggagatgaggctcaaagt
aagagagggatcctgactctgaagtaccctattgaacatggcatcgtcaccaactgggat
gacatggagaaaatctggcatcacactttctacaatgagctccgtgttgctcccgaggaa
caccctgtgctgcttacagaggcgccattgaatcccaaagccaacagagagaagatgaca
cagatcatgtttgagacattcaacactccagccatgtatgtggccattcaggctgtgctg
tctctgtatgcctctggccgtaccaccggtattgtaatggactctggagatggtgtgacg
cacactgtgcccatctatgagggttatgcccttccccatgctatcctgcgactggatctg
gctggccgtgaccttacagactacctcatgaagatcctgacagaaagaggctacagcttc
accaccacagccgaaagggaaattgtgcgtgacatcaaggagaagttgtgctacgttgcc
ttggacttcgagcaggagatggccacagctgcttcctcttcctccttggagaagagctat
gaattgcctgatggccaggtgattaccattggaaacgagaggtttaggtgtccagaagct
ctcttccagccctctttcctaggtatggagtcttgtggcattcatgagaccactttcaac
tccatcatgaagtgtgatgtagatatcaggaaggacctgtatgccaacacagtattgtct
ggtggtaccacaatgtacccaggaattgcagacagaatgcagaaggagatcaccgcattg
gctcccagtacaatgaagatcaagatcattgctcctcctgagcgcaaatactcagtctgg
attggtgggtccattctcgcatctctctctaccttccagcaaatgtggatcagcaagcag
gaatacgatgaatctggcccatccattgtccaccgtaaatgcttctaa

KEGG   Anolis carolinensis (green anole): 100567488
Entry
100567488         CDS       T01608                                 

Definition
(RefSeq) actin, cytoplasmic type 5
  KO
K05692  actin beta/gamma 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04145  Phagosome
acs04210  Apoptosis
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100567488
  09143 Cell growth and death
   04210 Apoptosis
    100567488
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100567488
   04520 Adherens junction
    100567488
   04530 Tight junction
    100567488
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100567488
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100567488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acs03021]
    100567488
   03019 Messenger RNA biogenesis [BR:acs03019]
    100567488
   03036 Chromosome and associated proteins [BR:acs03036]
    100567488
   03029 Mitochondrial biogenesis [BR:acs03029]
    100567488
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100567488
   04147 Exosome [BR:acs04147]
    100567488
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100567488
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100567488
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100567488
    NuA4 complex
     100567488
  Chromatin remodeling factors
   BAF complex
    100567488
   PBAF complex
    100567488
   SWR1 complex
    100567488
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100567488
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100567488
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100567488
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100567488
NCBI-ProteinID: XP_003228820
LinkDB
Position
Un
AA seq 376 aa
MADDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS
YELPDGQVITIGNERFRCPEAVFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVL
SGGSTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggctgatgatgagattgccgcgctggtggtggacaatggctccggcatgtgcaaagcc
gggtttgcgggggacgatgcgccccgggcggtgttcccctccatcgtgggacgtccccgg
caccagggagtgatggtggggatgggccagaaggacagctacgtgggagacgaggcccag
agcaagcgaggcatcctgactctcaagtaccccatcgagcatggcattgtcaccaactgg
gacgacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgag
gagcacccggtcttgctcaccgaagcgcccctcaaccccaaagccaaccgggagaagatg
acgcagatcatgttcgagaccttcaacacgcccgctatgtatgtggccatccaggcggtg
ctgtcactctacgcttcgggacgcaccaccgggatcgtcatggactccggcgacggcgtc
actcacacggtgcccatctacgaaggatacgccttgccccacgccatcctgcgcttggac
ctggccggccgagacttgaccgactatctcatgaagatcctgacggagcggggctacagc
ttcaccaccacggccgagagggagatcgtgagggacatcaaggagaagctctgctacgtg
gccttggattttgagcaggagatggccaccgctgcctcctcctcctccttggagaagagc
tacgagttgcccgacgggcaagtcatcaccatcggcaacgagcgcttccggtgccccgag
gccgtcttccagccctcgttcctgggcatggagtcgtgcggcatccacgagaccaccttc
aactccatcatgaagtgcgacgtggacatccgcaaggacctctacgccaacaccgtcttg
tccggcggcagcaccatgtatcccggcatcgccgaccggatgcagaaggagatcaccgcc
ctggctcccagcaccatgaagatcaagatcatcgctcccccagaacggaagtattcggtg
tggatcgggggctccatcttggcttctctgtccaccttccagcagatgtggatcagcaag
caagaatacgatgagtccggcccatccatcgtccaccgcaaatgcttttaa

DBGET integrated database retrieval system