KEGG   Anolis carolinensis (green anole): 100551529
Entry
100551529         CDS       T01608                                 

Gene name
aifm2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100551529 (aifm2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 K_oxygenase GIDA DAO FAD_binding_2 AlaDh_PNT_C Thi4 Lycopene_cycl Trp_halogenase Peptidase_S28 RMI2 DUF4147 FAD_oxidored
Other DBs
NCBI-GeneID: 100551529
NCBI-ProteinID: XP_003218521
Ensembl: ENSACAG00000017786
UniProt: G1KUD7
LinkDB
Position
3
AA seq 373 aa
MGSKVSVDASVRVVIVGGGFGGIEAALQLHSWEIPFLLVDMRDAFHHNVAALRASVDSGF
AKKTFISFSVTFKDSFRQGTVVGIDLDKQHVLLNDGEEIFFSHLILATGSDGPFPGKFNQ
VIDMQAAIQTYEDMAKEVQKAPRIVIVGGGSAGVEMAAEVKTMYPTKEVALIHSKIALAD
EELLPRVRQEVKETLIHEGVNLFLGQRVDNLHELTLHQFKENMVVKTDKGTEMVTDMVIL
CTGIKVNSSAYRSSFINKLASNGALKVNDHLQVEGYDNIYAIGDCADVKEPKMAYHAGLH
ADVAVTNIINSLTQKPLKIYTPGSLTFLISMGSNDGVGQISGIYIGHFLVTVAKSKDLFV
SKSWKKMGQHMPC
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggggtccaaagtgtctgtggatgcttcggtgcgtgtggtgatagtgggagggggcttt
ggtgggatagaagccgccctccagcttcatagctgggagattcctttccttcttgtggac
atgagagatgccttccaccacaacgtggctgccctccgagcctctgtagacagtggattt
gctaagaaaactttcatctccttctctgtgacctttaaagacagcttccggcagggcaca
gtagttgggattgacttggataaacaacatgttctgttgaatgacggtgaagagatcttt
ttttctcacctgatccttgccacagggagtgatgggcctttccctgggaaatttaaccaa
gttattgacatgcaggctgctattcagacctatgaagacatggcaaaagaggttcagaaa
gctccccgtatagtcattgtgggtggtggttctgctggtgtcgaaatggctgcagaagtg
aagacaatgtatcccacaaaagaggttgcattaattcactctaaaattgcattggcagat
gaagaattgcttcctagagtccgacaagaggtgaaagaaacccttatacatgaaggggta
aatctttttttaggtcagagagttgataacctgcatgagctgactttacaccaattcaag
gagaacatggtagtgaagactgataaaggcacagaaatggttactgatatggtgatcctt
tgcactggaataaaagtcaattcatcagcatatagaagttcattcattaacaaactggca
agtaatggtgctctgaaagtgaatgaccaccttcaggtagaaggatatgataatatttat
gccattggtgattgtgctgatgtgaaagagcccaagatggcctatcatgctgggctccat
gcagatgttgcagtgaccaatattatcaatagcctgacacagaaacctctgaaaatctac
actccaggatcacttaccttcctgatatcaatgggaagcaatgatggagttggacagatt
agtggaatctacattgggcatttcttagttactgttgccaaaagcaaagatctttttgtc
tcaaaaagttggaagaagatgggtcagcatatgccttgctag

DBGET integrated database retrieval system