KEGG   Anolis carolinensis (green anole): 100551545Help
Entry
100551545         CDS       T01608                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00020  Citrate cycle (TCA cycle)
acs00190  Oxidative phosphorylation
acs01100  Metabolic pathways
acs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100551545 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100551545 (sdha)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100551545 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100551545
NCBI-ProteinID: XP_003222362
Ensembl: ENSACAG00000009576
LinkDB All DBs
Position
6
AA seq 664 aa AA seqDB search
MAALATVVCRRLRQVPLFRPQGFAAGQVFSRNFHFTVYGKKNASAKVSDSISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEEGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFVLDLLMENGECCGVIALCIE
DGTIHRIRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPE
KDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGVPTNYKGQ
VITHVNGKDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAETCKPGEP
VPSIKPNAGEESVANLDKLRFANGSIRTSELRLDMQKTMQSHAAVFRTGPVLQEGCEKVS
SLYSSMDDLKTFDRGVVWNTDLVETLELQNLMLCALQTIYGAEARKETRGAHAREDYKVR
IDEYDYSKPIEGQQEKPFDQHWRKHTLSYVDVKTGKVSLEYRPVIDQTLNEEDCAAVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggcgacggtggtttgtcgaagactgcggcaggtgcctttattccgcccg
cagggatttgcagctggccaggttttctctcgaaacttccacttcacagtttatggaaag
aaaaatgcatctgctaaagtatctgattcaatttcaacacagtatcctgtagtggatcat
gaatttgatgcagttgttgtgggtgcaggtggtgcaggtctgcgagctgcatttggctta
tctgaggctgggtttaatacagcatgtgttaccaaattgtttcctaccagatcccatact
gttgctgcacagggaggaatcaatgctgctttggggaatatggaagaggataactggaga
tggcatttctatgatactgtgaaaggctctgactggttgggtgaccaggatgcaattcat
tacatgactgagcaagcccctgcttcagttattgagttggagaattatggtatgccattt
agccggacagaagaaggaaagatctatcagcgtgcctttgggggacagagtcttaagttt
gggaaaggaggccaggctcatcgctgctgctgtgtagctgaccggacaggacactccttg
ctacacaccctttatgggaggtctctcagatatgacaccagttactttgtggagtatttt
gtccttgatctccttatggaaaacggagaatgttgtggcgttattgcactttgtatagaa
gatggcaccatacatcgtataagagcaaagaataccgttatcgccactggagggtatggg
cgcacatacttcagctgcacatctgctcacacttgtactggagatgggacagctatgatt
actcgagcaggcctgccttgtcaagatttggaatttgtgcagttccatcccacagggatt
tatggtgctggctgccttattactgagggctgtcgtggtgagggaggcattctcataaac
agtgaaggtgaaaggtttatggagagatatgctccagttgcaaaggatcttgcatcaagg
gatgtggtgtctcgatctatgactattgagatccgtgaaggaagaggatgtggacctgag
aaagaccatgtgtacttgcagttgcaccatttgccacctcagcagctagccacacgtctt
cctgggatttcagaaactgctatgatatttgctggtgtggatgtcaccaaagaacccatt
cctgttctgcccactgtgcattacaatatgggaggcgtccctacaaactacaaagggcag
gtgattacacatgtcaatggcaaagatcaaatagtacctggcttgtatgcttgtggtgaa
gcagcctgtgcctctgtacatggtgctaatcgtcttggagcaaactctcttttggacttg
gtagtctttggacgtgcatgtgctcttagcattgcagaaacctgcaaacctggggaacca
gttccatcaattaaaccaaatgcaggtgaagaatctgtggcaaatttggataaattgcgc
tttgccaatggaagcatcagaacatcagaattgaggcttgatatgcaaaaaacaatgcag
agccatgctgccgtgtttcgtacaggccctgtcctacaggaaggttgtgagaaagtttcc
agcctttatagcagtatggatgacctgaagacatttgatagaggtgttgtttggaatact
gacttggtggagactttggagctacagaacctgatgctctgtgctttgcaaactatttat
ggtgcagaagctcggaaagagacacgtggtgctcatgctcgggaagattataaggttagg
atagatgaatatgattattctaaaccaatcgaaggacaacaggaaaagccatttgatcaa
cactggagaaagcataccctctcttatgtagatgtcaagacagggaaggtgtctctggaa
tatagacctgtcattgaccaaaccctgaatgaagaagattgtgcagcagttccacccgct
attcgctcatattag

DBGET integrated database retrieval system