KEGG   Anolis carolinensis (green anole): 100551571Help
Entry
100551571         CDS       T01608                                 

Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00512  Mucin type O-glycan biosynthesis
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100551571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acs01003]
    100551571
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100551571
Glycosyltransferases [BR:acs01003]
 O-Glycan biosynthesis
  Mucin-type
   100551571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100551571
NCBI-ProteinID: XP_016853291
Ensembl: ENSACAG00000008700
LinkDB All DBs
Position
Un
AA seq 608 aa AA seqDB search
MASLRRVKVLLVLNLLAVAGFVLFLAKCRPIAAKHGEAFHEMRPRPGAANLSNVPVQDAV
LKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPGEKRKQRGPHEKYGYNSY
LSEKISLDRTGTAFFSSHCHLGSAPPFQNHPCKELKYPKDLPQISIIFIFVNEALSVILR
SVHSAVNHTPAHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNRKREGLIRAR
IEGWKVASGQITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYEN
SAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRQFFGEIGLLDPGMDVY
GGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYK
SHVYIAWNLPLENPGIDIGDVSERKALRKNLRCKNFQWYLDHVYPEMRRYNNTVAYGELR
NNKVKDVCLDQGPQENHTAILYPCHGWGPQLARYTKEGILHLGALGTTVLLPDTRCLVDN
MKSRYPQLLDCDKVKSSLHKRWSFIQHGAILNKGTGRCLEVENKGISGMELILRSCTGQR
WTIKNIIN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgcggagagtgaaagtcctgctggtcttgaacctcctcgccgtggcgggc
ttcgtcctcttcctggccaagtgtcggcccatcgcggcgaagcatggggaggccttccac
gagatgcggcccaggccgggagccgccaatctctccaacgtccccgtccaggatgccgtc
ttgaagagactgtctctcctcgaagacattgtctaccgccagctcaacggtctgtccaaa
tccttggggctcattgaaggctatggtggccgcggcaaaggtggcttacctgccaccctt
tctcccggggagaagagaaagcaaaggggaccccatgagaaatatggctacaattcctac
ctgagtgaaaaaatatcactggaccgcaccggcaccgccttcttctcctcccactgccat
ttgggctccgccccaccgttccagaaccacccgtgtaaagagctgaaatacccaaaggat
ctcccacagatttcgattatttttatctttgtgaacgaggcgttatctgtcatcctgcgt
tcagttcacagcgcggtgaatcacactccggcccacctgttgaaagagatcattcttgta
gatgacaacagcgacgaagaggaattgaaggcaccactagaagaatacgtcaataagcgg
taccctggcctcgtgaaagtggtacgaaaccggaaaagggaaggcctgatccgggctcgc
attgaaggatggaaagttgcgtcgggccagatcaccggcttctttgatgctcacgtcgaa
ttcacagcaggctgggctgagcctgttctctcacgaatccaggaaaaccgaaaaagagtc
atccttccctctattgataatatcaagcaggatacgtttgaggtgcaacgctatgaaaat
tcagcccacggatacagttgggaactttggtgcatgtacatcagtcccccgaaggattgg
tgggatgctggagatccttccttgccaatcaggactccggctatgataggatgctctttt
gtggtcaaccgacagttctttggtgaaattggtcttctcgatccaggaatggatgtttac
ggtggagagaatatcgagctcggaatcaaggtatggctctgcggtggtagcatggaagtc
cttccctgttctcgggttgcgcacattgaacgcaagaagaagccgtacaacaacaacatt
ggcttctacacaaagaggaatgccttgcgggtggccgaggtgtggatggacgattacaag
tctcatgtgtacattgcgtggaatctgcctctggagaacccaggaattgacattggagac
gtttctgagcgaaaagccctccggaaaaatctgaggtgtaaaaacttccagtggtatctg
gaccatgtctacccagaaatgagaagatataataatacagtcgcctatggagagctacgc
aataacaaagtgaaagatgtctgcctggatcaaggaccgcaggaaaaccacaccgcaatc
ctatatccatgtcatggatggggacctcagcttgcccgctataccaaagaaggaattctt
catttgggtgcccttgggaccacagtcctcttgccagacactcgctgcttggtggataat
atgaagagccgataccctcagctcctcgactgtgacaaagtgaagagcagcctgcacaag
cggtggagttttatccagcacggtgcgattctaaacaaagggacaggacgctgcttagaa
gttgagaacaaaggcatttcaggtatggagctcattcttcggagctgcacaggacaaagg
tggaccattaaaaatattatcaattaa

DBGET integrated database retrieval system