KEGG   Anolis carolinensis (green anole): 100551688
Entry
100551688         CDS       T01608                                 

Gene name
fas
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04060  Cytokine-cytokine receptor interaction
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04217  Necroptosis
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100551688 (fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100551688 (fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100551688 (fas)
   04217 Necroptosis
    100551688 (fas)
   04115 p53 signaling pathway
    100551688 (fas)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100551688 (fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acs04050]
    100551688 (fas)
   04090 CD molecules [BR:acs04090]
    100551688 (fas)
Cytokine receptors [BR:acs04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100551688 (fas)
CD molecules [BR:acs04090]
 Proteins
  100551688 (fas)
SSDB
Motif
Pfam: Death TNFR_c6 DUF2207
Other DBs
NCBI-GeneID: 100551688
NCBI-ProteinID: XP_003224413
LinkDB
Position
Un
AA seq 322 aa
MTGKLLLYLLTLCPACSLISGPSLDNDSHRPYKKRFAVKRISKRDGIICQLNMQYQFNTT
TGVICCSSCNPGSVAINIGCTKTYPITKCKNCIEGKEYMDKFNHKTKCLRCNDCDKEHGL
EVETNCTANQNVKCKCRPGFFCNSPPCQHCDPCDTCENGTVLEKCTETQNTKCQRREHVP
WYKWALPILFVILVAVPVIFIICKRMRNNRRTYRIPPGDKNNETEPMYPDIDLTPCIPDI
AEEMKLEQVMKFVRKLGVSPVCIDAVKNNNNNDVTEQKIKLLECWYQETGRKGAFKTLIT
TLDKLDLRATADKIQQKINPEA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactggcaaactccttctctaccttttaacattgtgtcctgcatgtagcttaatttct
ggaccatcgcttgataatgattcacacagaccatataaaaagcgttttgcagtgaaacgt
atttctaagcgggatggtattatctgtcaacttaacatgcaatatcaattcaatacaact
actggtgtcatctgctgtagctcttgtaatcccggttctgttgctataaatattggttgt
acaaaaacttatcctataaccaaatgcaaaaactgcatagaggggaaagagtacatggac
aaattcaatcataaaaccaaatgtctgcggtgcaatgattgtgacaaagaacatggactg
gaagttgaaacaaattgtactgctaatcagaatgtgaaatgtaaatgcagacctggtttc
ttttgcaattctccaccatgccaacactgtgacccatgtgatacgtgtgaaaatggtaca
gttttagaaaagtgcactgaaactcaaaataccaaatgtcaaaggagagaacatgtaccg
tggtataagtgggcacttccaattctttttgtgattttggttgcagttcctgtgatattc
attatatgtaagagaatgagaaataacaggaggacatacagaatcccacctggagataag
aacaatgaaacggagcctatgtatccagatattgacttgaccccttgtattcctgacatt
gcagaggagatgaaactagagcaagtaatgaagtttgttcggaaattgggtgtatcccct
gtttgtatagatgcagtcaagaataataataacaatgatgtcactgagcagaaaataaaa
ttattagagtgctggtatcaagagacaggcagaaaaggtgcctttaagactctaatcacc
accctggataaacttgatcttcgtgctactgctgataagattcaacaaaaaataaatcct
gaggcatga

DBGET integrated database retrieval system