KEGG   Anolis carolinensis (green anole): 100551935
Entry
100551935         CDS       T01608                                 

Gene name
prkaa2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100551935 (prkaa2)
   04068 FoxO signaling pathway
    100551935 (prkaa2)
   04150 mTOR signaling pathway
    100551935 (prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100551935 (prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100551935 (prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100551935 (prkaa2)
   04920 Adipocytokine signaling pathway
    100551935 (prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100551935 (prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100551935 (prkaa2)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100551935 (prkaa2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100551935 (prkaa2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100551935 (prkaa2)
Membrane trafficking [BR:acs04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100551935 (prkaa2)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100551935 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    100551935 (prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100551935
NCBI-ProteinID: XP_003220224
Ensembl: ENSACAG00000006771
LinkDB
Position
4
AA seq 554 aa
MAEKPPPPQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLD
VVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEETEA
RRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGS
PNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKIRGGVFYIPEY
LNRSVATLLMHMLQVDPLKRATIKDMREHEWFKQDLPNYLFPEDPSYDANVIDDDAVREV
CEKFECTESEVMASLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSM
HIPPGVKPHPERMPPLVADSPKAKCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMA
EVYRAMKQLEFEWKVVNAYHLRVRRKNPVTGNFVKMSLQLYQVDNRSYLLDFKSIDDDVM
EQRSGSSTPQRSCSAARLHRPRLSFDSASADYQPLSGSLSGSFTGSMPSVTPRLGSHTMD
FFEMCASLIMALAR
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggcagagaagcctcctccgccgcagaagcacgacgggcgcgtcaagatcggccactac
gtcttgggagacacgctgggcgtcggcaccttcggcaaagtcaagattggtgaacatcag
ctcacaggacataaagtagcagtcaaaattttgaataggcaaaaaatccgcagtttggat
gtggttggaaagatcaaacgagaaattcaaaacttaaagcttttccggcacccccatatt
atcaaactgtaccaggtcatcagcacgccaacggattttttcatggtaatggaatatgtg
tccggtggggaattatttgattacatctgtaaacacggacgggtggaagagactgaagcc
agacgtcttttccagcaaattctgtcagctgtagattactgtcatcggcacatggtggtt
catagagatttgaaaccagagaatgtgctgttggatgcacacatgaatgccaagatagct
gattttgggttgtccaacatgatgtctgatggtgaatttctccgaaccagctgtggctca
cccaactatgcagcaccagaagtcatctctggaaggttgtatgctggtccagaggttgat
atttggagctgtggcgttattctttatgctcttctctgtgggactcttccttttgatgac
gaccatgtcccaacactctttaaaaaaatccgtggaggtgtcttctacattcctgaatac
cttaaccgctcagttgctactctactgatgcatatgttgcaggttgacccactcaaaaga
gcaaccataaaggatatgcgagaacatgagtggttcaagcaggatctgcccaattacttg
tttcctgaagacccttcctatgatgccaatgtcattgatgatgatgctgtgcgggaggtt
tgtgagaaatttgaatgcactgaatcagaggtgatggcaagcctatacagtggagatcct
caagatcaacttgcagttgcttatcaccttattattgacaatcggagaatcatgaaccaa
gccagtgaattctacctcgcttccagccctccttctggctcttttatggatgactctatg
cacatccctccaggggtaaaacctcacccagagcggatgcctccattggtagcagatagt
cccaaagcaaaatgtcccctcgatgcactgaataccactaagccaaaaccattgactgtg
aaaaaggccaagtggcatttagggatacggagtcaaagcaagccttatgatatcatggct
gaagtctaccgtgctatgaaacaactggagtttgaatggaaggtggtgaatgcttatcat
cttagagttcgtagaaaaaatccagtgacggggaatttcgtaaaaatgagtttgcagctg
tatcaggttgacaatcgtagctatctactggactttaaaagtattgatgatgatgtcatg
gaacaaagatcaggctcttccactcctcagcgctcatgctctgcagctcgactgcacaga
ccaagactgagttttgattctgcctctgctgattaccaaccactttcggggtctctcagt
ggctccttcacaggtagcatgccctctgttacacctcgccttggcagccataccatggat
ttctttgaaatgtgtgctagtctcatcatggctcttgcacgctga

KEGG   Anolis carolinensis (green anole): 100553465
Entry
100553465         CDS       T01608                                 

Gene name
prkab1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100553465 (prkab1)
   04068 FoxO signaling pathway
    100553465 (prkab1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100553465 (prkab1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100553465 (prkab1)
   04920 Adipocytokine signaling pathway
    100553465 (prkab1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 100553465
NCBI-ProteinID: XP_003226038
Ensembl: ENSACAG00000003403
UniProt: H9G7H2
LinkDB
Position
Un
AA seq 267 aa
MGNTSSERSGVERQGGHKTPRSGAKDGDRPKILMDSPEDADLFHSEEMKASLEKEEFLAW
QHDVEVKDKAPTQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEH
QYKFYVDGHWTHDPSEPVVTSQMGTLNNVIQVKKTDFEVFDALMVDSQKCSDVSELSSSP
PGPYHQEPYICKPEDRFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALS
IKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggggaacactagcagcgaacgttcaggagtggagcgccagggaggccacaaaactcct
cgctcgggagctaaggatggagaccggcctaagatcttgatggacagccctgaagatgcc
gacttattccattcggaagaaatgaaggcttcattggagaaagaagaattcctggcttgg
cagcacgacgtggaggtgaaggacaaggccccgacccaagcacgtccgaccgtctttcgc
tggactggaggagggaaagaagtttatttatctggctcttttaacaactggagcaaactt
ccactgacaaggagccacaataattttgtagcaatccttgatcttccagaaggtgaacac
caatacaagttttatgtggatgggcattggacacacgatccttcagagcctgtagtaacc
agccagatggggaccctcaacaacgttattcaggtgaagaaaacagactttgaagtcttt
gatgctttaatggtggactcccagaagtgctctgatgtgtctgagctctcaagttcacct
cctgggccctaccaccaggaaccctacatctgtaagcccgaggatcggttcaaatctccc
cctattcttcctccacacctgctgcaggttattctcaacaaagacactgggatttcgtgt
gatccagctctgcttcccgagcctaaccatgtcatgctgaatcacctctacgcgctctcc
atcaaggacggggtgatggtgctcagtgccacccaccgttacaagaaaaagtatgtgacc
accttgctgtataagcccatatga

KEGG   Anolis carolinensis (green anole): 100553577
Entry
100553577         CDS       T01608                                 

Gene name
prkag2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100553577 (prkag2)
   04068 FoxO signaling pathway
    100553577 (prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100553577 (prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100553577 (prkag2)
   04920 Adipocytokine signaling pathway
    100553577 (prkag2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100553577
NCBI-ProteinID: XP_003221957
LinkDB
Position
6
AA seq 568 aa
MGSTAMDTKKKKDASSSSGCKKSSGQKKRLLRVHIPDLSSFAMPFLDGDVDNSEKHASRK
TEDNYTTGSPSRGLFSKGLQNRPSSPASAPVKSKHSPGSPKTVFPFPYQESPPRSPRRMS
FSGIFRSSSKDSSSPASNPSTSPGGIKFFSRSRKTSGLSSSPSTPTQATKQPTFPLESYK
HEPERLETRIYTPSSPPDTGQRLGQPPGQSVAKPPTPAPTPCATSKAVSMEGALGPSVLG
MFKTSQFSFTAVGESESDIYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLYDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVSEMPKPAFM
KKNLDELGIGTYHNIAFIHPDTPIIKALNIFVDRRISALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVKAEVHRLVVVNEADSI
VGIISLSDILQALVLSPTGAIQKEGEAE
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggggagcactgccatggacaccaagaagaagaaagatgcctcttccagcagcggctgc
aagaaaagctccggccagaagaagcgcttgttgcgagtccacatcccagatctcagctca
tttgccatgccgttcctggatggagatgtggacaattcagagaaacatgcctcacgaaag
acagaagacaactacaccacaggcagcccttccagaggacttttctcaaaggggctccag
aaccggccttccagcccagcctctgctccggtcaaatctaagcatagcccaggttcaccc
aaaacagtgttccctttcccgtaccaggagtccccgcctcgctccccgcgccgcatgagc
ttcagcggcatcttccgctcctcctccaaggactcttcctccccggcctccaacccatct
acctcccctggcgggatcaagttcttctccagatcaagaaaaacctctggcctgtcctct
tctccatcaaccccaacgcaagcgaccaaacagccaacatttcctctggaatcctacaaa
catgaacctgaaaggctagaaacacggatctacacgccctcctctcctccggacaccggc
cagaggctcggtcagcctcccggacaaagcgtggccaagccccccaccccagcgcccacc
ccctgtgctacctcaaaagcagtaagtatggaaggggctttgggtccgtctgtgttaggg
atgttcaaaacttctcaattttcttttacagctgttggagaatcagaaagtgatatctac
atgcgttttatgaggtcgcacaagtgttatgatattgtcccaaccagttcaaaacttgtt
gtttttgacactacgctacaggttaagaaggctttctttgccttggtggcaaatggtgtt
cgagcagcaccgctgtgggagagtaaaaaacaaagtttcgtaggaatgttgactattaca
gatttcattaatatattacatagatattacaaatctccaatggtacaaatctatgaatta
gaggagcacaagattgaaacatggagagagctttatttgcaagaaacctttaagccttta
gtgaatatttcaccagatgcaagcctttatgatgctgtgtattcactgatcaaaaacaaa
atccacagattgccagttattgatcctgtgagtggaaatgcactttatatccttacccat
aaaagaatactcaagtttctccagctttttgtgtcagaaatgccaaagcctgcctttatg
aagaaaaatctggatgaacttgggataggaacttaccataatatcgcctttatacacccg
gacactcctatcattaaagctttgaatatatttgtagatagaaggatatcagcactacct
gttgtggatgaatcaggaaaagttgtagatatttattccaaatttgatgtaattaatctt
gctgctgaaaaaacttataataacttagatatcacggtgacgcaagccctccaacaccgc
tctcagtattttgaaggtgttgtgaaatgcagtaagctggaaacactggagaccattgtg
gatcggatagtaaaagccgaggttcatcggttggtggtagtgaatgaagccgatagtatt
gttggtatcatctccctctctgacatcctacaagcactagtgctttctcccacaggtgcc
atacaaaaggaaggcgaagctgaatga

KEGG   Anolis carolinensis (green anole): 100554551
Entry
100554551         CDS       T01608                                 

Gene name
prkab2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100554551 (prkab2)
   04068 FoxO signaling pathway
    100554551 (prkab2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100554551 (prkab2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100554551 (prkab2)
   04920 Adipocytokine signaling pathway
    100554551 (prkab2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 100554551
NCBI-ProteinID: XP_003219919
Ensembl: ENSACAG00000013182
UniProt: G1KNE5
LinkDB
Position
4
AA seq 274 aa
MGNTTSERVSGERHGSKSHRSDGGSSSQHAKDHSNKIMVGSTDDPNVFSTHESKLPGDKE
FVSWHHDLDESVKPYQQARPTVIRWTDGGKEVFISGSFNNWSAKIPLIKSHNDFVAILDL
PEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKVDSLESSETSC
RDLSGSPPGTYSQEMYVYRPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVML
NHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 825 nt   +upstreamnt  +downstreamnt
atggggaacaccactagtgagagggtatctggggaacgccacggctccaagtctcatcgt
tctgatggaggtagcagcagccaacatgccaaggatcattcaaacaagatcatggttgga
agcactgatgatcccaatgttttcagcacacatgaatccaagcttcctggagataaggaa
tttgtgtcatggcatcatgacttggatgagtcagtaaagccatatcaacaggctcgtccc
actgttattcgttggactgatgggggcaaggaagtcttcatctcgggatccttcaacaac
tggagtgcaaagatacctttaattaaaagccacaatgactttgttgctattctggacctt
cctgaaggggaacaccagtacaaattctttgtggatggccagtgggttcatgatccatct
gagccagtggtgactagtcagctggggacaattaacaatctgattcatgtcaagaagtct
gactttgaagtgtttgatgctttaaaggtggactccctggaaagttcagagacttcttgt
cgagacctttctggctctcctcctggaacatacagccaagaaatgtacgtctataggcct
gaggagcgtttcaaatccccaccgattctccctcctcatctcctccaggtcatccttaat
aaggatactaacatttcatgcgatccagccctcctgcctgagccaaatcatgtgatgctg
aaccatctgtatgcactctccattaaggatggtgttatggtactcagtgccacccatcgc
tacaagaagaaatatgttactaccctgctgtacaagcccatttga

KEGG   Anolis carolinensis (green anole): 100562137
Entry
100562137         CDS       T01608                                 

Gene name
prkag1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100562137 (prkag1)
   04068 FoxO signaling pathway
    100562137 (prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100562137 (prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100562137 (prkag1)
   04920 Adipocytokine signaling pathway
    100562137 (prkag1)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100562137
NCBI-ProteinID: XP_003216997
Ensembl: ENSACAG00000008069
UniProt: G1KHH2
LinkDB
Position
2
AA seq 330 aa
MEADTIAESGLEKSLSLSEADGDSSSGVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKTQSFVGMLTITDFINILHRYYKSAMVQIYELEEHKIETWREV
YLQDSFKPLVCISPSASLYDAVTSLIRNKIHRLPVIDQDSGNTLYILTHKRILKFLKLFI
AEFPKPEFTSKTLEELKIGTYENIAMVQTDTPIYVALGIFVQHRVSALPVVDESGRVVDI
YSKFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGVLKCYKHETLETIINRLVDAEVHRL
VVVDENDVVKGIVSLSDILQALVLPGGQKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggaggcggacaccattgctgagagtgggttggagaaaagcttgtctttgtcagaagca
gatggtgattccagcagtggcgtctacacatccttcatgaagtcccatcgctgctatgac
ctcatcccgacaagctcgaagctcgtggtgtttgacacttctcttcaggtaaagaaagcc
ttctttgctttggtgaccaatggtgtgcgggctgccccactctgggacagcaaaacacaa
agctttgtgggaatgctcacaattacagacttcatcaacatcttgcatcgctactacaaa
tcagctatggtgcagatctatgagctggaggaacacaagattgaaacatggcgagaggtg
tacctgcaggactctttcaagccacttgtctgtatttcacccagcgccagcctgtatgat
gctgtcacttctttgatccggaacaagatccatcggcttccggtcattgatcaggattca
gggaacactctgtacatcctgacgcacaagcgcatcctgaagttccttaaactctttatt
gcagagtttcctaagccagagtttacatccaaaaccctagaggagttgaagattggcacc
tatgaaaacattgccatggtccagactgatactcctatctatgttgcgctgggcattttc
gtacaacaccgagtctctgcattgcctgtggtggatgagtcaggtcgggttgtggatatt
tattccaagtttgatgtcattaatctggcggcagaaaaaacatacaacaacttggatgtg
acagtgaccaaagcactgcagcaccgctctcagtattttgaaggtgtgctcaagtgttac
aagcatgaaactctggagacgataatcaacaggctggtggacgcagaggttcatcggctg
gttgtggtggatgagaacgatgtggtgaagggtattgtgtccctttcggatatcctgcag
gccctggtccttcctggtggtcagaagccctga

KEGG   Anolis carolinensis (green anole): 100564629
Entry
100564629         CDS       T01608                                 

Gene name
prkag3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100564629 (prkag3)
   04068 FoxO signaling pathway
    100564629 (prkag3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100564629 (prkag3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100564629 (prkag3)
   04920 Adipocytokine signaling pathway
    100564629 (prkag3)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100564629
NCBI-ProteinID: XP_008110421
LinkDB
Position
1
AA seq 636 aa
MLGVVVLRGLSPSPDCNCRDSIGSSSGVRLRSCSLLQTHCLSPASGAALLRRLLAHLEAL
RWTRGGGAGLPSLLPLQAALPSASGVFMPGPPPSRTPRRLGPSPERGAMERQEDAAEKAP
VASEQALPLNNGLQHQEAGPVLSRDIKESALEANAGVLETKDLIAEGKTAKLNGMSGGRS
MNCDPEVVARDAKAANGSGRVTGLTAETADAKAKELDEAENGRPEATGTENKQVNPSRKE
CVILGDMNGDRKARVTAPGDKDVCQHIQGPDLDPTGAAAIIAATATAATTVETTLLEQRN
KESDGDIISLDCEILGFGPDIDFLGPDAELYMQFMRSHHCYDAIPTSSKLVVFDTTLQIK
KAFFAMVANGVRAAPLWDNKKKCFVGMLTITDFINILHRYYRSPLVQIYEIEEHKIETWR
EVYLQSSYKPLVCISPNDSLFDAVYSLIKNKIHRLPVIEPISGNVLHILTHKRILKFLHI
FGAMLPKPRFLQRTILELGIGTFRDVAIVLESAPVYTALETFVDRRVSALPVINDKGSVV
GLYSRFDVIHLAAQKSYNNLDISVGEALKQRSVCLEGVLTCHPYETMEEIIDRIAKEQVH
RLVLVDEKNAPRGIVSLSDILQALVLTPAGIDRHSL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgctgggagttgtagttttacgaggactttcgccttctccagactgtaattgccgtgat
tccataggcagttcaagcggtgtcagactgcgttcatgcagcttgctacagacgcactgc
ctctctccggcctcgggcgccgctctgctgaggaggcttctggcccatctggaagcgctg
cggtggacgaggggcggcggggcgggccttccctctctcctccccctccaagctgccctc
ccctccgctagcggtgtgtttatgccaggcccaccgcccagccggacgccccggcgcctc
ggcccttcgcccgaaagaggagccatggagaggcaggaggacgcggcggaaaaggcgcca
gtggcctcggagcaggcattaccactgaacaatggtctccagcatcaggaagcaggcccc
gtcctttctcgagatattaaggaatctgctttggaagccaacgcaggagttctggagacc
aaagacctcattgcagagggcaaaactgccaagctgaatgggatgtcaggtggccggagc
atgaactgtgatcccgaagttgtggcacgagatgccaaggcagcaaacggaagtggcaga
gtgacaggactgactgccgagaccgcagatgcaaaggccaaagagttggatgaagctgaa
aatggtcggcctgaagccacaggaacagagaataagcaagtgaatccaagcagaaaggag
tgtgtgatcctaggagacatgaatggtgacaggaaggccagagtcactgcaccaggtgat
aaagatgtctgtcaacatatccaaggaccagacctggatccaacaggagcagcagcaatc
atagcagcaacagccacagcagcaacaacagtggaaactactctgcttgaacagagaaac
aaagaaagtgacggggacatcatttctctcgattgtgaaattcttggctttggccctgac
attgactttttggggccagatgctgagctctatatgcagtttatgcggagccaccactgt
tatgatgccatccccaccagctcaaaactggtagtgtttgacaccaccttgcagattaag
aaggccttctttgccatggtggctaatggggtgcgagctgctcctctctgggacaacaaa
aagaaatgttttgtgggtatgctgactatcactgactttattaacatcctacatcgctac
taccgatcacctctggttcagatatatgagattgaggagcacaaaattgaaacatggcga
gaggtgtatttgcaaagttcctacaaacccctagtgtgcatctccccaaatgatagcctc
tttgatgctgtttattccttgattaagaacaaaattcaccggctgcctgtgattgagccc
atctcagggaatgtccttcacatcctgacacacaagcggatccttaagtttctgcatatt
tttggcgccatgcttccaaagccacgtttcctgcagagaaccatcctggagctgggcatt
ggcaccttccgggacgttgcgattgtactggagtcagctcctgtttacacagctctggag
acttttgtggaccgcagagtttcagcattgccggttattaatgacaaagggagtgtagtt
gggctctactcccgctttgatgtgattcacttggctgcccagaagtcctacaacaacctg
gatataagtgtgggggaagcactgaagcaacgctcagtttgcctagaaggagtgctcaca
tgccacccgtacgaaacgatggaagagataattgaccgtatcgccaaagagcaggtccat
cgcctagttctggtggatgagaagaacgctccgcgggggatcgtgtccctctctgacatt
ctccaagctctggtgctcacgcctgcaggcattgaccgccattcactctga

KEGG   Anolis carolinensis (green anole): 100567445
Entry
100567445         CDS       T01608                                 

Gene name
prkaa1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100567445 (prkaa1)
   04068 FoxO signaling pathway
    100567445 (prkaa1)
   04150 mTOR signaling pathway
    100567445 (prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100567445 (prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100567445 (prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100567445 (prkaa1)
   04920 Adipocytokine signaling pathway
    100567445 (prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100567445 (prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100567445 (prkaa1)
   03029 Mitochondrial biogenesis [BR:acs03029]
    100567445 (prkaa1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100567445 (prkaa1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100567445 (prkaa1)
Membrane trafficking [BR:acs04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100567445 (prkaa1)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100567445 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    100567445 (prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100567445
NCBI-ProteinID: XP_008101051
Ensembl: ENSACAG00000010236
UniProt: G1KJX3
LinkDB
Position
2
AA seq 550 aa
MAAADKQKHEHGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDV
VGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESR
RLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSP
NYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYL
NPAVISLLKHMLQVDPMKRATIRDIREHDWFKLDLPKYLFPEDPSYSSTMIDDEALKEVC
EKFECTEEEVLGCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHFSR
PHPERVPFLVAELPRQRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIK
QLDYEWKVVNPYYLRVRRKNPVTGTYSKMSLQLYQVDSRTYLLDFRSIDDEINEVKSGTA
TPQRSGSVTNYKSCQKDSDTDAQGRSSDMSLTSSVTSSLDSSSAELTPRSGSHTIEFFEM
CANLIKILAQ
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcggcggcggataaacagaaacatgagcacgggcgggtgaagatcgggcactacatc
ttgggggacacgctgggcgtgggcaccttcggcaaagtcaaggttggcaagcatgagctg
actgggcacaaagtagcggttaagatcttgaacagacagaagattcgcagtcttgacgtc
gtgggtaaaatccgcagagaaattcagaatctgaagctttttcggcatccacacataatt
aagctgtaccaggttatcagcacaccctctgacattttcatggttatggaatatgtttca
ggaggtgaattgtttgattacatctgtaaaaatggaaggcttgacgaaaaggagagtaga
cgcctcttccagcaaatcctttcaggtgtggattattgccataggcacatggtagttcac
agagacttgaaacctgaaaatgtactactcgatgcacacatgaatgccaagattgctgat
tttggcctttcaaatatgatgtcagatggagaatttttgagaacaagctgtggctctcct
aattatgctgctccagaagtaatttccggaagattatatgcaggcccagaagtggatatc
tggagcagtggagttattctttatgctctgttatgtgggacccttccgtttgacgatgat
catgtgccaacactttttaagaaaatatgtgatggtatattttatactcctcagtacctg
aatccagcagtaattagccttttgaaacacatgctgcaggtggatcctatgaagagagct
acaataagagatataagggaacatgactggttcaagctcgacctccccaagtacctcttt
cctgaagacccatcgtacagttcaaccatgattgatgatgaagccttaaaagaggtctgt
gagaagtttgaatgcacagaggaggaagtacttggctgcttgtataatcgaaatcatcag
gatcctttagccgttgcctaccacttgattatagataacaggagaataatgaatgaagct
aaagacttttacttggcaacaagcccaccagattcctttcttgacgatcacttctcccgc
ccccaccccgaaagagtgccatttttagttgctgaattaccaaggcagcggcatacgctt
gatgagctaaacccacagaagtccaaacaccaaggagtcagaagagcaaagtggcatttg
ggaattcggagtcagagtcgaccaaatgacataatggcagaagtttgtcgagcaatcaaa
cagttggattatgaatggaaggttgtaaatccatactatttgcgtgttcgaaggaagaat
ccagtgactggcacttattccaaaatgagtctacagttataccaggtggacagtagaact
tatctattggatttccgtagcattgatgatgaaattaatgaagtcaaatctgggactgcc
actccccagaggtcaggctctgtgacaaactacaaatcttgtcagaaagattcggacact
gatgctcaaggaagatcctctgatatgtctcttacctcctctgtgacctcttccctcgac
tcatcttcagctgagttgaccccaagatcagggagccacacaatagaattttttgaaatg
tgtgcgaatcttattaaaatacttgcgcaatga

DBGET integrated database retrieval system