KEGG   Anolis carolinensis (green anole): 100552320Help
Entry
100552320         CDS       T01608                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acs01002]
    100552320 (tmprss2)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100552320 (tmprss2)
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100552320 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100552320
NCBI-ProteinID: XP_008105690
Ensembl: ENSACAG00000005446
UniProt: G1KE28
LinkDB All DBs
Position
3
AA seq 486 aa AA seqDB search
MNSRPPPYYENYAYQPENIAPPRHAGGYMYPPYPSPYYPSSVPHYIPRVSTNQSTPVPTV
VQPKATPAKCMPKTRKAVCLFLAISVLLIGGAIAAVLIWHFVTDSCFGSKIKCGTTGMCV
APSQWCDGIRDCPNNEDETRCVRLFGPEFQLEVYSSESKDWYPVCSDDWNDKHGKTACED
LGYNSNTYFKSQTIPLMSASKGFMKLNASAGDIDLYKKLYNSKSCSSRSLVSLQCIDCGT
RRVNRRNRIVGGTSASLGDWPWQVSLHSSGTHLCGGSIITPEWIVTAAHCVEKAFSNPNY
WTVFAGILTQPEMISSKGHKVAKVIPHPGYDTSSKTNDVALMKLQSPLVFDEFVRPVCLP
NPGMMFQSDQPYWISGWGAVEQKGPTSKKLNAARIRLIDSDTCNNRYIYNGLILPTMICA
GYLNGGIDSCQGDSGGPLVTSKDSLWWLVGDTSWGTGCATKYRPGVYGNMTVFTDWIYKN
MQANRR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaggccgccaccatattatgaaaactatgcctatcagccagaaaatattgct
cctccaaggcatgctggtggttacatgtatccaccatatccatctccatactatccttca
tcagtgccacattacattccaagggtttccactaatcaatcaactccagtgcctacagta
gtacagccgaaggctacacctgcaaagtgcatgccaaaaaccaggaaagctgtgtgtctg
ttcctagcaatttcagtactactaataggaggtgcaattgctgctgttctcatttggcat
tttgtgacagacagttgttttggctccaagataaaatgtggtacaacaggaatgtgtgtg
gcaccatctcaatggtgtgatggaatacgtgattgcccgaataatgaagatgaaacccgt
tgtgtgagactttttggaccagaatttcaactggaggtctattcatctgaaagcaaagat
tggtaccctgtatgttctgatgattggaatgataaacatgggaagacagcctgtgaagat
ctgggatataactcgaatacatatttcaagagccagacaataccactcatgagtgcatct
aaaggctttatgaagctgaatgcaagtgctggggatatagacttgtataagaaattgtat
aatagtaaaagctgctcatcaaggagtctggtgtctctgcaatgcatagactgtggcact
cgacgtgtaaaccgtcgaaacagaattgtgggagggacctctgcctcccttggagattgg
ccctggcaagtcagccttcattccagtggcacccatctgtgtggagggtctattatcact
cctgaatggatagtaacagcagctcactgtgtagaaaaggcattttctaatccaaactat
tggacagtttttgctgggatattgacacagccagaaatgatttcttcaaagggacataaa
gttgcaaaagtaattcctcatccaggctatgatacatcttctaaaacaaatgatgttgct
cttatgaagttacagtccccacttgtttttgatgaatttgtacgaccagtttgtttgcca
aaccctggaatgatgtttcagtcagatcagccgtactggatatctggatggggagcagta
gaacaaaaaggtcccacttcaaaaaaactgaatgcagcacgcatacgtctgatagattct
gatacatgtaataacagatacatctataatgggctcatcttgccaaccatgatttgtgct
ggctacctaaacggaggaatcgattcttgtcagggtgacagtggtggtccattggtaacg
tccaaagatagtttgtggtggttggtgggtgacacaagttggggaacaggctgtgctaca
aaatatagacctggagtttatggcaacatgactgttttcacagactggatttacaaaaat
atgcaggcaaacagacgatga

DBGET integrated database retrieval system