KEGG   Anolis carolinensis (green anole): 100552443Help
Entry
100552443         CDS       T01608                                 

Gene name
setdb2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100552443 (setdb2)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100552443 (setdb2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100552443 (setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100552443 (setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET zf-HC5HC2H MBD zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100552443
NCBI-ProteinID: XP_008114661
LinkDB All DBs
Position
1
AA seq 1049 aa AA seqDB search
MEVDAKLFWSHLDSNTVDLMFERLQRVLLSLQQKIKDGTATEEECCQAFAFIQQVDMTDI
LPLTNVNVASDEDIQNCELDLHSSPSSGVREDPGNVFSFGRMETNEVLSSRSKRMLTGKA
SKVPYQAHTCSKNCLAKRPWNSYKGENPLCLPLLCHFQRRHAKPDAVFKSHDVMYRAPCG
KTLRNFQDVQKYLFQTECNFLFLDHFSFNTYVQVFRNTPSHQSCEFDFDISKGVETVPVS
FCNDIDHSQLPYFKYRKTSWPHGYFLNNFSSTFLDSCSCTDGCIDRTKCACLRLTERKCH
EVSDSSGKGKFIGYRYKRLDEPVPSGIYECSLLCTCDKSMCQNRLVQHGLQERLQVFNTE
KKGWGVRCLDDIDKGTFVCTYSGRLMNRNESWQVKDGDGDDDKEEDAENSNGSNNLLSIK
IEAVCSDSQTELNQTGMQKYLHVKPEDQPDIIQNSSYKKRWHNQTVKRPETRTSILQRHR
RQLGIADASSDEDVSAECQKPVRRGVTATTPKGHENLHLEVGELVNPVQPKVNTDHHAGN
PLSIAALNSTPPVQDEKQCRDLLWTGNACTEELGRGKWESFQNEEAMEDDESQLKAKEVP
YLLDATREGNVGRFLNHSCSPNLFVQSVFVETHNRNFPWVAFFTNRHVKAGTELTWDYGY
EAGSMPEIETPCYCKALKCRKKILLPTLGFYESGCYLHHQKGCWGSTGSNSGGEERGDVR
RRSLLLPRMRGKPADVISPARRSLAAVELLLSRKTTLIMAKMVRRRCAFCPEDEECAIMY
VAEGQDLAVHQDCLLYSSGFVESEEYSSDNLDIRFKVASVVNEIKRGRRLMCYFCRKKGA
TVGCEIKHCRRGYHYFCALCDDAAIETDDVKGTYRSALRVFCPNHDPAKKNSFYDEDSKR
GRSPVPMKSSSTRQKMNNKETVVEENLQALRKRQNQHKGKIEFLRKCKQAGLLDEIFEEM
LDTLHLAQEKLMDDNTSETEYEDTVMSLFDCGLFENILTAAQSGTEEKIQELLNTRKRLD
AQIGILQDLKEVVLSSPGDTISISNSTSE
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgatgcaaaactattctggagtcatttggatagcaacacggtggatttgatg
tttgaacgactgcaaagagtgctgttgtctctgcagcagaaaatcaaggatggaactgca
accgaggaagaatgctgccaagcttttgcatttatacaacaagtggatatgactgacatc
ttacctctgacaaatgtaaatgttgcttctgatgaagatattcagaattgcgaacttgat
ttgcattcttctccctcaagtggagttagagaagatcctggaaatgttttttcttttgga
agaatggagacaaatgaagtgttgtcttcaaggagtaaaagaatgctaaccggaaaggcg
tcaaaggttccatatcaagctcatacctgctcaaaaaattgtcttgccaaaaggccatgg
aactcatataagggcgagaaccctctttgcctgccactgctgtgtcatttccagaggagg
cacgcaaaacccgatgctgtcttcaagtcgcatgatgtgatgtacagagctccttgtgga
aagactctgagaaatttccaagatgtgcagaaatatttgtttcaaacagaatgcaacttt
ttatttttagatcacttttccttcaatacctatgtgcaggtgtttagaaacacacctagt
catcaatcgtgtgaatttgattttgatatcagtaaaggtgttgagacggtaccagtttct
ttctgtaatgatatagaccacagtcagctgccttattttaaatatcggaagacttcatgg
ccacatggatacttcctgaacaatttctccagcactttccttgactcatgcagctgcacc
gatggctgcatcgacaggacaaaatgtgcctgcctgcgtcttactgagagaaagtgccat
gaagtgtcagattcttcaggaaagggaaaattcattggctatcgttacaaaaggctggat
gaaccagttcctagcggaatttacgagtgcagcttgttgtgtacctgtgacaagagcatg
tgccagaacagattagtgcagcatggtcttcaagagcggctccaggttttcaacaccgaa
aagaagggctggggggtccgttgccttgatgatattgacaaagggacgtttgtttgtacg
tactcaggcagactgatgaacagaaatgaatcttggcaagtaaaggatggtgatggagat
gatgataaagaggaggatgcagagaatagtaacgggagcaacaacttactttcaattaaa
atagaagctgtctgttctgattcacagactgaacttaaccaaactgggatgcaaaaatat
ttgcatgtaaaacctgaagatcagccagatataattcagaactccagctacaaaaagcgt
tggcataaccaaactgtcaaaaggccagaaaccagaacatctattcttcagcgtcaccgg
agacaactaggtattgctgatgccagctcagatgaagatgtgagtgctgagtgccagaaa
ccagtaaggagaggagtgactgctacaaccccaaaaggacatgaaaatctacatttagag
gtcggagaacttgtgaatcctgtacagcccaaagttaatacagaccaccatgcagggaat
cctctttccattgctgctttgaacagcacaccacctgtgcaggatgaaaagcaatgcaga
gacttactttggactggtaatgcatgcacagaagagcttgggaggggcaaatgggaatct
tttcaaaatgaggaagcaatggaagatgatgaatcacagctaaaggccaaggaggttcct
tatttgctggatgccactagagaaggcaatgtgggccgatttcttaatcacagctgctcc
ccaaatctctttgtacagagtgtatttgtagagacccacaacagaaatttcccatgggtg
gctttcttcacaaacaggcatgtaaaagctggaactgaactcacatgggattatggttat
gaagctggaagtatgcccgaaatagaaacaccctgttactgcaaggctctgaagtgcagg
aaaaaaatactacttccaactctaggattttatgagtctggctgctatttgcatcaccaa
aagggatgctggggctccactgggagcaattctggtggggaggagcgtggtgacgtcaga
cgcaggtcccttctcctgccgcgcatgcgtggtaaacccgcggacgtcattagtccggcg
cgaagatccctggctgccgttgagcttctgctttccaggaaaacgaccttgataatggca
aagatggtaagaagacgatgtgcattttgccctgaagatgaggaatgtgccattatgtat
gttgctgaaggacaggatcttgcagtccatcaggattgtctgttgtattcctcaggattt
gtagagtctgaagaatacagttcggacaatcttgatatacggttcaaggtggcttcagta
gtgaatgaaataaagagagggaggaggctgatgtgctatttctgtcgcaagaaaggagcc
acagttggctgtgagataaaacactgtcgcagaggctatcattatttctgtgcactgtgt
gatgatgcggcaatagaaacagatgacgtgaaaggcacttaccgttctgcattaagagtg
ttttgtccaaatcatgaccctgccaagaaaaacagtttttatgatgaagatagtaagagg
ggaaggtccccagtccccatgaaatcttcatcgactagacaaaaaatgaataataaagag
acggttgtagaagaaaacctacaagccctcaggaaaaggcagaaccaacataaaggaaag
atagaatttttaagaaagtgtaagcaggctgggcttcttgatgaaatatttgaggaaatg
ttagacacacttcatctggcgcaggaaaagctaatggatgacaacacttcagaaacagaa
tatgaagacaccgtaatgtcactttttgattgtggcctctttgaaaacatacttacagct
gctcagtcaggaacagaagaaaaaattcaggagctactaaatacaagaaagagattggat
gcccagattgggattcttcaagatttgaaagaagtagtactttcttctccgggagacaca
atcagcatatctaacagtacctctgaataa

DBGET integrated database retrieval system