KEGG   Anolis carolinensis (green anole): 100552508
Entry
100552508         CDS       T01608                                 

Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04144  Endocytosis
acs04150  mTOR signaling pathway
acs04270  Vascular smooth muscle contraction
acs04310  Wnt signaling pathway
acs04350  TGF-beta signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100552508
   04350 TGF-beta signaling pathway
    100552508
   04150 mTOR signaling pathway
    100552508
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100552508
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100552508
   04520 Adherens junction
    100552508
   04530 Tight junction
    100552508
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100552508
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100552508
   04625 C-type lectin receptor signaling pathway
    100552508
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100552508
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100552508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100552508
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100552508
   04031 GTP-binding proteins [BR:acs04031]
    100552508
Membrane trafficking [BR:acs04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100552508
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100552508
  Exosomal proteins of other body fluids (saliva and urine)
   100552508
  Exosomal proteins of colorectal cancer cells
   100552508
  Exosomal proteins of bladder cancer cells
   100552508
GTP-binding proteins [BR:acs04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100552508
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100552508
NCBI-ProteinID: XP_008101765
LinkDB
Position
2
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYLECSAKTKDGVREVFEMATRAALQ
AKRGRKKTSCQLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatacgcaagaaactcgtcattgtaggagatggagcttgtggaaagacatgc
ctccttatcgtcttcagcaaagaccaattcccagaagtctacgtccccactgtttttgag
aactacgttgctgacattgaagtggatggaaaacaggtggagcttgctttgtgggataca
gctggccaagaggactatgaccgtttgagacctctttcttacccagacacagatgtcatc
ctcatgtgtttttccatcgacagccctgacagtttagagaacatccctgagaaatggact
ccagaagtgaagcatttctgtcctaatgtgcctatcatcctggtgggaaacaagaaggat
ttgcgtaatgatgaacacacacggcgggagctggccaagatgaagcaggaaccagtgaag
ccggaggagggccgggacatggccaacaggattggtgcatttggctacctggaatgttct
gccaagacaaaggatggggtacgggaagtgtttgagatggccacccgggctgccctgcaa
gccaagcgtgggcgcaaaaagacctcgtgccagctgctgtaa

KEGG   Anolis carolinensis (green anole): 100566989
Entry
100566989         CDS       T01608                                 

Gene name
rhoa
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04144  Endocytosis
acs04150  mTOR signaling pathway
acs04270  Vascular smooth muscle contraction
acs04310  Wnt signaling pathway
acs04350  TGF-beta signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100566989 (rhoa)
   04350 TGF-beta signaling pathway
    100566989 (rhoa)
   04150 mTOR signaling pathway
    100566989 (rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100566989 (rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100566989 (rhoa)
   04520 Adherens junction
    100566989 (rhoa)
   04530 Tight junction
    100566989 (rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100566989 (rhoa)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100566989 (rhoa)
   04625 C-type lectin receptor signaling pathway
    100566989 (rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100566989 (rhoa)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100566989 (rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100566989 (rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100566989 (rhoa)
   04031 GTP-binding proteins [BR:acs04031]
    100566989 (rhoa)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100566989 (rhoa)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100566989 (rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   100566989 (rhoa)
  Exosomal proteins of colorectal cancer cells
   100566989 (rhoa)
  Exosomal proteins of bladder cancer cells
   100566989 (rhoa)
GTP-binding proteins [BR:acs04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100566989 (rhoa)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU REV SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100566989
NCBI-ProteinID: XP_003217600
Ensembl: ENSACAG00000008297
LinkDB
Position
2
AA seq 235 aa
MRAWTRLAFDPPRCFPFSAIAGVWAQRRRKRRRRRKQRSPAVMAAIRKKLVIVGDGACGK
TCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD
VILMCFSTDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEP
VKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLLL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagagcgtggacgcgccttgctttcgacccgccccgttgctttccgttctcggccatt
gccggagtttgggcccagaggaggaggaagaggcggaggagaaggaagcagcggagccct
gcagttatggcagccattcggaaaaagctggttatagtcggtgatggtgcctgtggcaag
acctgtctgctcattgtatttagtaaagaccagttccctgaagtttacgttccaacagta
tttgaaaactatgtagcagatattgaagttgatggaaagcaggtggagctggctttatgg
gatacagcaggacaagaagattatgatcgacttaggcctctttcttaccctgacactgat
gttatacttatgtgtttttcaacagatagtcctgatagtttagaaaacattccagagaaa
tggactccagaagtgaaacacttctgccccaatgtacccatcatcttggtaggaaataag
aaggatttgaggaatgatgaacacacaaggcgagagctggccaaaatgaagcaggaacca
gtcaaacctgaagagggcagggatatggctaaccgcattggtgcttttggatacatggag
tgcagtgcaaagaccaaagacggtgtgagggaagtttttgaaatggccactagagccgct
ttacaagctcgacgtggcaagaaaaaatctgggtgccttctcttgtaa

DBGET integrated database retrieval system