KEGG   Anolis carolinensis (green anole): 100552562
Entry
100552562         CDS       T01608                                 

Gene name
tsc2
Definition
(RefSeq) tuberous sclerosis 2
  KO
K07207  tuberous sclerosis 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04218  Cellular senescence
acs04910  Insulin signaling pathway
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100552562 (tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100552562 (tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100552562 (tsc2)
   04218 Cellular senescence
    100552562 (tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100552562 (tsc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100552562 (tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100552562 (tsc2)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100552562 (tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 100552562
NCBI-ProteinID: XP_008122202
Ensembl: ENSACAG00000008490
LinkDB
Position
Un
AA seq 1808 aa
MAKPQSKDPGLKEKFKSLLGLGQSRPNSKSSEGKQTEFIITAEILKELSPECGLNNRIKA
IGQICEVAKTKKFEEHAVEAIWKAVADMLQPDRPAEARHAVLHLLKAIIQGQGERLGILR
AHFFKVIKDYPSNEDLHERLEVFKALTDNGRYITYLEEELAEFVLQWMQVGLTSEFLLVL
VNLVKFNSCYLDDYIATMVRTICFLCIQTSSAVDIEVSLQVLDAVVCYNRLPSETLPAFI
VTLCWTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRTHMEDAVLLRGAVFFVG
MALWGAHRLQSLKNSATSVLPSFLKAMTCPNAVVSYEIVLSITRLIKKYGKGLQAVTWDI
LLDIMEQLLQQLQTLESQELKSIVHDLLTTVEELCDQNDFHGSQERYFELVERCANERPE
SSVLNLITYRAQSIHPAKDGWIQNLQVLMERFFRNESRSAIRIKVLHVLSFVLSVNRQFY
EEELINLVVISQLAHIPDDKDHQVRKLATQLLVDLAEGCNTHHFNSLLDIIEKVASHSLL
PPPELEERDLLSYSASLEDVKTAVLGLLVILQTKLYSLPASHATRVYEMLVYHIQLHYKH
KYSLPVAASIRLQVFDFLLSLQADSLHRLGLACKDGPVRFSPYCLCDFVEPEKKPAGPLS
PPSGSPSLPPQSPAVRTGHLPYSLLFGVLLQCLKQETDWKVLKLVLNKLPWSLQYKVLFL
TSPCNIDQLSSALCNMLTDKKMTERLKGIPEGLSRNDLHLAVVPVLTALISYHSYLDKTK
QREMVYCLEHGLIYRCANQCVVALSICSVEMPDIIIKALPVLIVKLTHISATANMAIPLL
EFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIKCRLPF
RKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSSFKVAKSARQSLNHSPPV
KELRETSPAEAFRSRSISVSDHAAHSRIQTSITSASLGSADENSVAQADDNLKNLHLELT
ETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTITTSVGTGTRSLLGL
DSGELQSSTESSRSEHPLQVRQTKEAPAKLQSQAGPQVVRTRNRVRSMSGGHALRVGALD
SSSSHFPSNPISQGSQAPLAPRNEKTTPGAPQKEKANLAAYVPLLTQGWAEILVRRPTGN
TSWLMSLENPLSPFSSDINNMPLQELSNALMAAERLKEHRETALYKSLSVPSSSLPTGTA
KPSLLQRSNTESAVVLEEGSPPDADPKEKPTHPESQEIEDFEAAASDQGLLLVGEKLSKG
HGTYSRSSSTSSQEEKPLKPEDLASLGIPIEGSRPLEDRRALEALSFQPSQPLSKSSSSP
ELQTLQEALKEPSHEGLSGKNSAGEVKSGHSEREAAGGWTARGAAEEERAAPGGGARATG
GIPASLPHSPTGHRPRGYTISDSAPSRRGKRAEREPFRTRATPAAAATSNAEKVPGINPS
FVFLQLYHSPFFGDETNKPLLLPNETFERSVQLLDQIPPYDTHKIAVLYVGEGQSHNELA
ILSNEHGSYRYTEFLTGLGKLVELKDCQPDKIYLGGLDVGGEDGQFTYCWHDDIMQAIFH
IATLMPTKDLDKYRCNKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVVIKPLDYNC
NLLTLQCRKDMEGLVDTSVAKIVSDKNLSFVARQMALHANMASHVHHSRSNPTDTYPSKW
IARLRHIKRLRHRIREETQYQASGFPAMHPPATGKASAHMPPDTAAPTYETGQRKRLISS
VDDFTEFV
NT seq 5427 nt   +upstreamnt  +downstreamnt
atggccaagcctcagagcaaggacccgggtctgaaggagaagttcaagagcctcttaggc
ctggggcagtccaggcccaattcgaagtcatcggaagggaagcagaccgaattcatcatc
acggcagagatactcaaggaactgagcccagaatgtggcttgaacaaccggattaaagcc
attggccaaatctgtgaagtagcaaaaactaaaaaatttgaagagcatgcagtggaagca
atctggaaggccgttgcagatatgctgcagccggaccggccggccgaagccagacacgcc
gtacttcacctgctgaaagccattatccaaggacagggcgaaaggctggggatcctccgt
gctcacttctttaaagtgatcaaagattacccttcaaatgaagacctgcatgaacggctc
gaagtcttcaaagctctgacagataatgggagatacataacttacctggaggaagaactg
gctgaatttgtcctccagtggatgcaagttggtctgacgtccgaattccttctagtactc
gtcaatttggtcaaattcaacagctgctacttagatgactatattgccaccatggtccgc
acaatttgctttctatgcatccagacgtcctctgctgttgatattgaagtctcgctgcag
gtcttggatgccgtggtgtgttataaccgcctgccttccgaaacgctccctgcctttatt
gtcactttgtgttggaccatcaatgtgaaggaactctgtgagccatgctggaagctcatg
cggaacctgttgggaactcacttagggcatagtgccatctacaacatgtgccggatcatg
gaagacaggacccacatggaggatgccgtcttgctgcgaggggccgtcttcttcgtggga
atggccttatggggggcccaccggctgcagtctctcaaaaactctgctacatcggtgctg
ccttctttcctgaaggccatgacatgtcccaacgccgtcgtgtcttatgaaattgtcctt
tccatcacccggctgatcaagaaatacggaaagggcctccaagccgtcacttgggacatc
ctcttggatattatggagcagttgctgcagcagctgcagaccctggaaagccaggaattg
aagtccatcgtccacgacttgctgaccaccgtggaggagctgtgcgaccagaacgacttc
catggatcgcaggagagatactttgagctggtggagagatgtgccaacgaaagaccagaa
tcctctgtcctgaacctgatcacgtaccgagcgcaatccatccacccggcgaaggatgga
tggatccagaacctgcaagtcttgatggaaaggttcttcagaaacgaaagccggagcgcc
atccgcatcaaggttttgcacgtcctttcttttgtcctgagcgtcaaccggcagttttac
gaggaggagctgattaacctggtggtcatctcccagttggcccacatcccggacgacaag
gaccaccaagtccggaagctggcgacacagctgctggtggacctggccgagggttgcaac
acccatcatttcaatagcttgctggatatcatcgagaaggttgcctctcattccctgctt
ccccctccggagctggaggaaagggacctcctctcctattcggcctctttggaggacgtg
aagacggccgtcttgggcctgctggtcattctccagaccaagctctacagcctccctgcc
agccacgccacccgcgtttatgagatgctggtctaccacatccagctccactataaacac
aagtacagcctccccgttgccgccagcatccggctgcaggtgtttgacttcctgctctcg
ctgcaggccgactccctccaccgcctgggcttggcctgcaaggacggccccgtcaggttc
agcccttactgcctctgcgacttcgtggagcctgagaaaaaacccgccggcccgctttcg
cctccgtcggggagccccagccttccccctcagagcccggccgtccgcaccggtcacttg
ccatattcactgctctttggggtcctcctgcagtgcttgaagcaggagacggactggaaa
gtcctgaagctggtactgaacaagttgccctggtctctgcagtacaaggtcctgttcttg
acctcaccttgcaacatcgaccagctgtcttcagccctctgtaatatgctcacggacaaa
aagatgactgagcgcctgaagggcatcccagaagggctttcccggaacgacctccatctg
gccgtggtcccagtgctgaccgctttgatctcttaccacagctatctggacaaaaccaag
cagagggagatggtctactgcctggagcacgggctgatctaccgctgtgccaaccagtgc
gtcgtggcgctgtccatctgcagtgtagagatgccggacatcatcatcaaggctctgccg
gtcctcatcgtcaagctgacccacatctcggccacggccaacatggccatccccctcctg
gagttcctttcgacattggcccggctgccccatctctacaggaattttgccgcagagcaa
tatgccagcgtcttcgccatctccctgccctacacaaacccctccaagtttaaccagtac
atcgtctgcctggcgcaccacgtcatcgccatgtggttcatcaagtgccggctccctttc
cggaaagatttcgttccttacattaccaagggcttgcgttcgaatgtcctcctctccttc
gatgacactcctgagaaggacagtttccgggcacgaagcaccagcctgaacgaaaggccc
aagagtagttttaaagtagccaaaagtgccaggcagagcttgaatcactctcctcccgtg
aaagagctgagagagacctcgccggccgaggccttccggtcacgcagcatcagcgtctct
gaccatgcggcccacagccggatccagacgtccatcaccagtgccagcctggggtcggca
gatgagaactcggtggcgcaagcagacgacaacctcaagaacctgcatttggagctgact
gagacctgcctcgacatgatggcccgatacgtcttctccaacttcaccgctgtgcccaaa
aggtctcctgtgggagagtttctcttggccggaggaaggaccaagacctggctggtgggc
aacaaactggtgaccatcacaactagtgttgggacaggaacccggtcgcttctggggctc
gattccggggagctgcagagcagcacagagtcaagccgttcagaacatcccctgcaagtc
agacagaccaaagaggccccggctaaactccagtcccaggctggtccacaagtggtccga
acccgcaacagagtcaggtccatgtctggtggccacgctttacgggtcggtgccttggac
agttcctcctcccatttcccatccaatcccatatcccaggggtcccaggctcccctggct
ccccggaatgagaagaccactcccggggctccgcagaaggagaaggctaacctggccgcc
tacgtcccgctgctgacccagggctgggccgaaatcctggtgcggaggccgactgggaac
accagttggctgatgagcctggagaacccgctaagccccttttcttcggacatcaacaac
atgcctctgcaggaactctccaacgccctcatggcggccgagcggctcaaggagcaccgg
gagacggccctctacaagtcgctttcggtgccctcctccagcctccccaccgggacagcc
aaaccctccctcttgcagcgctccaacacagagtctgccgtcgttttggaagaaggaagc
cccccagacgccgacccgaaagagaagcccactcacccagaatcccaggagattgaggac
tttgaagccgcggcctccgaccaaggcctcctcctcgtgggagagaagttgagcaaaggg
catgggacatatagtcggtcttcctcaacctccagccaagaggagaagcccctgaagccg
gaagacctggcctccctgggcatccccatcgaggggagccgccccctggaagaccgccgg
gccttggaggccctctccttccagccctcgcagcccctcagcaagtccagctcctcaccg
gagctccagaccctccaggaggccctcaaggaacctagtcatgaaggtctctccgggaag
aacagcgccggggaggtcaagtcgggacactcggagagagaggctgcgggcggatggacg
gcgaggggagccgcggaggaggagagggccgcccccggaggaggggcccgggcgacgggg
ggcatcccggcctctttgccccactccccgaccggacaccggccccgcggatacaccatc
tccgactcggccccctcccggcgcggaaagagggccgagagggagcccttcaggaccagg
gccacccccgctgctgccgccacctccaatgcggagaaggtgcccgggatcaaccccagc
tttgtcttcctgcagctgtaccactctcctttcttcggtgatgaaaccaacaagcccctc
ttgctgccaaatgagacctttgaaagatctgttcaactcctggaccagatccctccttac
gacacccacaagattgcggtgctgtacgttggagaagggcagagccacaatgagctggcc
atcctgtccaacgagcacggctcctaccgctacacggagttcctgaccggcttgggcaaa
ctggtggagctcaaggactgccagccggacaagatctacctgggcggcctggacgtgggc
ggggaggatgggcagttcacctactgctggcatgacgacatcatgcaagccattttccac
attgccactttgatgcccaccaaggacctggacaaataccgctgcaacaagaagaggcac
ctgggaaatgactttgtttccatcgtttacaatgactctggggaagacttcaaactgggg
accatcaagggccagtttaactttgtgcatgtcgtcatcaagcccctggattacaactgc
aacctcctgactctccaatgcaggaaagatatggaaggacttgtcgacaccagcgtggca
aaaatcgtctcggataaaaacctgtcctttgtcgcccgtcagatggctttacatgctaat
atggcatcccacgtccatcacagccgctccaaccccacagacacctatccctccaaatgg
atcgcgaggctgcggcacatcaagaggctgcggcaccggatccgggaagaaacccagtac
caggcctccggcttccccgccatgcaccctccggccacgggaaaggcctctgcccacatg
cccccggacacggcggcacccacatacgaaacggggcaaaggaagcgcctgatctcttca
gtggacgacttcacggagttcgtgtag

DBGET integrated database retrieval system