KEGG   Anolis carolinensis (green anole): 100552624
Entry
100552624         CDS       T01608                                 

Gene name
stk11
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04530  Tight junction
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100552624 (stk11)
   04150 mTOR signaling pathway
    100552624 (stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100552624 (stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100552624 (stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100552624 (stk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100552624 (stk11)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100552624 (stk11)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100552624 (stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100552624
NCBI-ProteinID: XP_016854140
Ensembl: ENSACAG00000013986
LinkDB
Position
Un
AA seq 458 aa
MDLEPQQLGMFVESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYG
KVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEE
KQKMYMVMEYCVCGMQEMLDSVPEKKFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPGN
LLLTTNGTLKISDLGVAEALHPFAEDDVCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSA
GVTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPEDCGPPLSDLLRGMLEYDPSKRFSIQ
QIRHHNWFRKKHTQSEALVPIPPSPETKDRWRSMTVVPYLEDLHGYNEEEDDDEGLKEDY
LEDEIIYTQDFTVPGQVPDQEAQQNGQSRHRGGGGGTLLPKPLCMNGTESGPPGNKAKAE
RRDSKSAASIPPRKASASSATAASAGSKIRKLSTCKQQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggatctggagccccagcagttgggcatgtttgtcgaaagcgaattgatgtcggtaggc
atggacacgttcatccatcgcatcgactccacggaagtgatctaccaaccccggcggaag
agagccaagctcattggcaaatacctgatgggggatttgctcggagaagggtcttatggc
aaagtcaaggagatgctggactccgaaaccctctgcaggagagcggtcaagatcctgaag
aagaagaaactgcgccggatccccaacggcgaagccaatgtgaaaaaggaaatacagctc
ctgcgtcggttacggcacaaaaacgtaatccagttggtcgacgtgttgtacaacgaggag
aaacagaagatgtatatggtgatggagtactgtgtgtgcggcatgcaggagatgttggac
agcgtccctgaaaagaagtttccggtctttcaagcacacgggtatttttgccagctgatc
gatggcttggagtatctgcacagccagggcatcgttcacaaagacatcaaaccagggaac
ctcttgctcacaaccaacgggacgctgaagatttcagacctgggagtggcagaggctttg
cacccgtttgctgaggacgacgtgtgccggacgagccagggctcccctgcttttcagcct
ccggaaatcgccaacggcctcgacaccttttcgggcttcaaagtggatatttggtccgcg
ggcgtcacactgtacaacataacaaccggcctttatccctttgagggcgataatatttat
aagctgtttgaaaacattgggaaaggggactacacgatcccggaagactgtggccctccg
ctctcggacctgcttagaggaatgcttgaatacgatccatccaagaggttttcaatacaa
cagatcaggcaccacaactggttccggaagaaacacacgcagtcggaggccctggtgccc
atcccgcccagcccggagaccaaggaccggtggcggagcatgacggtggtgccttacctg
gaagacctgcacggctacaacgaggaggaggacgacgacgagggcctgaaggaggactat
ctggaggacgagatcatctacactcaggacttcaccgttccaggacaggtgcccgaccag
gaggcccagcagaacggacagagccggcaccgaggaggagggggggggacgctgctgccg
aagcccctctgcatgaacgggaccgagtcggggccgccgggaaacaaggccaaggccgag
cgcagggacagcaagtcggccgcctccatcccgccccgcaaggcctccgcctcctccgcc
accgccgcctccgccggaagcaagatccgcaagctctccacctgcaagcagcagtga

DBGET integrated database retrieval system