KEGG   Anolis carolinensis (green anole): 100552734
Entry
100552734         CDS       T01608                                 

Gene name
thbs1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04145  Phagosome
acs04350  TGF-beta signaling pathway
acs04510  Focal adhesion
acs04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100552734 (thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100552734 (thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100552734 (thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100552734 (thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100552734 (thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100552734 (thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:acs00536]
    100552734 (thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:acs04990]
    100552734 (thbs1)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100552734 (thbs1)
Glycosaminoglycan binding proteins [BR:acs00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100552734 (thbs1)
Domain-containing proteins not elsewhere classified [BR:acs04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   100552734 (thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 EGF_CA TSP1_ADAMTS EGF TSP1_CCN Laminin_G_3
Other DBs
NCBI-GeneID: 100552734
NCBI-ProteinID: XP_008115057
LinkDB
Position
Un
AA seq 1177 aa
MELSSGLFLLLMLGVHANNRIPEPGDDNSVFDLFELIGFGRKGAARKAAGVHPVKGPEIS
SPAYRIEDANRIPAIPDHKFQDILYAIQAEKGFILLANLRPVKKSPGTLLAVERKDNSGH
VFKLVLNGKAKTLDLSIFPKEGNQSLVSVEDVELPHAQWNNITLLVEEDQAQLYVGCEKM
VNAELEIPIQNIFTRDLASSARLRIAKGGFNDNFQGMLQNVRFVFGTTLETILRNKGCES
STRTIIKLDNPINGSRPAIRTNYIGHKTKDIQAICGFTCDELTNVFVELQSLRALVTTLQ
DSVHKVNGVMELVRGPFAISPGACLHNQVVYQNTAEWTTDSCTTCTCQNSVVICHKVSCP
LMPCSNATVPDGECCPRCWLSDSAEDIWSPWSEWTTCSATCGNGIQQRGRSCDRINHRCE
GSSVQTRICNMQECDKRFRQNGAWSHWSPWSSCSVTCGSGVITRIRLCNSPLPQMGGKEC
EGEARENVPCEKSPCPINGNWGPWSPWDACPVTCGGGVQKRGRLCNNPEPQYGGKDCIGE
VSDTQICNKQNCPIDGCLSNPCFAGTTCTSFPDGSWKCGACPAGYHGNGVKCKDIDECKE
VPDACFVLGGVHRCENTEPGYNCLPCPPRFTGTQPFGRGVDHAIANKQVCKPRNPCTDGT
HDCNKHARCIYLGHFSDPMYRCECKPGYAGNGNICGEDTDLDGWPNENLVCVANATYHCN
KDNCPTFPISGQENMRKEGMGDACDRDDGEXRTSLNDRDNCPFIYNPQQYDYDRDDVGDR
CDNCPYNHNPDQIDTDNNGEGDACAVDIDGDGILNERDNCQYVYNVDQKDTDLDGVGDQC
DNCPMEHNPEQTDSDSDRIGDTCDSNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDA
CDHDDDNDGIPDDKDNCRLVPNPDQLDSDGDGRGDACKDDFDKDNVLDIDDICPENVDIS
ETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFF
INTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWDIQPTKAQGYSGLSIKVVNSTTGPG
THLRNALWHTGNTAGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMA
DSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3534 nt   +upstreamnt  +downstreamnt
atggagctctccagcggactctttctgctcctgatgctgggcgtccacgccaataaccgg
atcccagagcctggcgatgacaacagtgtttttgatctctttgaactcattggctttggt
cgcaagggagcagcccggaaagcagcgggtgtccacccggtgaagggaccagagatttcc
agccctgcctaccgcattgaggatgccaaccgcatccctgcaatccctgaccacaaattc
caagacattctgtacgccatccaagctgagaagggcttcatcctattagctaaccttcgc
ccagtgaagaagagccctggcaccctgctggccgtggagcgcaaggacaactccggccat
gtcttcaagctggtgctgaacggcaaggcaaaaaccttggacctgagtatctttcccaag
gaaggcaaccagtctctggtctcagtggaggatgtggagctgccccacgcccagtggaac
aacatcaccctcttggtcgaagaagatcaggctcagctttatgtgggatgtgagaaaatg
gtgaacgccgagctggaaatccctattcagaacatcttcaccagagacttggccagcagt
gccagactccgcattgccaaaggaggattcaatgacaacttccagggcatgttgcagaat
gtgcgctttgtgtttggaaccacactagaaaccatcctaaggaacaaaggctgtgagagc
tctacaaggaccatcattaagttggacaatcccataaatggttcccgcccagccattcgt
accaattacattggccataaaacaaaagacatccaggcaatctgtggattcacctgtgac
gaactgaccaatgtatttgtggaactgcaaagcttgcgtgctctggttacaacacttcag
gattcagtccacaaagtaaatggcgtcatggaattagtgaggggcccgttcgcaataagt
cctggagcttgccttcataaccaagttgtgtaccaaaacacagctgaatggaccacagat
agctgtactacatgtacttgccagaattccgtcgttatctgccacaaagtgtcttgccct
cttatgccttgttctaatgccactgttcctgatggagaatgctgcccaagatgttggctc
agtgactctgcagaagatatttggtctccttggtctgagtggacaacgtgctccgcaaca
tgtggaaatggaatacagcagagaggacgctcttgtgacagaatcaaccaccgctgcgaa
ggctcttccgtgcaaacacgaatctgcaacatgcaggaatgtgataagagattcagacaa
aatggtgcctggagccactggtccccttggtcttcctgctctgtcacttgtggaagtggc
gtgatcaccagaatccgcctgtgcaactctcctcttcctcagatgggtggcaaagagtgt
gaaggagaagcaagagaaaacgtgccttgcgagaaaagcccttgtccaatcaatggaaac
tggggaccatggtcaccatgggatgcctgtccagtcacttgtggagggggtgttcagaag
cgtggccgtctctgcaacaatcctgaaccccagtatggagggaaggattgtattggtgaa
gtttctgatacccagatctgcaacaagcagaattgcccaattgatgggtgcctctctaat
ccttgctttgcgggaacaacatgtaccagttttcctgatggttcctggaaatgtggtgct
tgccctgctggctatcatggaaatggtgtcaaatgcaaggatattgatgagtgtaaagag
gtcccagatgcctgctttgtcttgggtggagtgcacaggtgtgagaatactgagcccggg
tacaactgtctgccttgcccaccacgttttactggaacgcagccctttggccgaggggtg
gatcatgcaatagccaacaagcaggtctgcaaaccacgtaatccctgtactgatggaact
catgactgtaacaagcatgcccggtgtatttaccttggccacttcagtgaccccatgtac
cgctgcgaatgtaaaccaggctacgctggcaatggcaatatctgtggagaagacacagac
ttggatggatggccaaatgagaaccttgtctgtgttgccaatgcaacttaccattgcaat
aaagataactgcccgacctttcccatttctggacaggagaatatgagaaaggagggaatg
ggggatgcttgtgacagggatgatggagaatgacgaacatctctgaatgacagggacaac
tgcccattcatttacaacccacagcaatatgactatgatagggatgatgttggtgaccgc
tgtgataactgtccctacaatcacaaccctgaccagatagatacagataataatggagaa
ggagatgcttgtgctgtggatattgatggtgatggcattcttaatgaaagagacaactgc
cagtatgtgtacaatgtggatcagaaagatacagacttagatggtgttggtgatcaatgt
gacaactgccctatggaacacaatcctgaacagacggattccgactctgaccgcattggt
gacacatgtgatagcaaccaggacattgatgaagatggccatcaaaataatcttgataac
tgcccctatgtgcccaatgctaaccaagccgaccatgacaaagatgggaaaggtgatgcc
tgtgaccatgatgatgacaacgatggcatcccagatgataaggataattgtagacttgtt
cccaacccggaccagcttgattcagatggtgatggacgtggagatgcatgcaaagatgac
tttgacaaagataatgtcctagatattgatgacatctgcccagagaatgttgacatcagt
gagacagacttccgccgatttcagatgattcccctggatcctaagggaacatctcaaaat
gatccaaactgggttgttcgtcatcaaggcaaagaattggttcagactgtcaactgtgat
cctggacttgcagttggtttcgatgaatttaatgctgttgatttcagtggcacattcttc
attaatacagacagggatgatgactatgcaggctttgtgtttggttatcagtccagcagc
cgtttttatgtagtcatgtggaaacaagtgacacagacctattgggacatacagccaacc
aaagctcagggatattcaggtctttctatcaaagtagtgaattccaccactggtcctgga
acacaccttcgtaatgcactgtggcacactggaaatacagctggacaggtgcgaactctg
tggcatgaccctcgtcatataggctggaaagacttcactgcctacagatggcgtctcagt
cacagaccaaagactggctacattcgggttgtaatgtatgaaggaaagaagatcatggct
gactctggtcccatctatgacaaaacctatgctggtggtcggttaggattatttgtcttc
tctcaagaaatggtgttcttctcggatcttaaatatgaatgtagagatccatga

DBGET integrated database retrieval system