KEGG   Anolis carolinensis (green anole): 100552812Help
Entry
100552812         CDS       T01608                                 

Gene name
pfkm
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00030  Pentose phosphate pathway
acs00051  Fructose and mannose metabolism
acs00052  Galactose metabolism
acs01100  Metabolic pathways
acs01200  Carbon metabolism
acs01230  Biosynthesis of amino acids
acs03018  RNA degradation
Module
acs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100552812 (pfkm)
   00030 Pentose phosphate pathway
    100552812 (pfkm)
   00051 Fructose and mannose metabolism
    100552812 (pfkm)
   00052 Galactose metabolism
    100552812 (pfkm)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100552812 (pfkm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100552812 (pfkm)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acs03019]
    100552812 (pfkm)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100552812 (pfkm)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100552812 (pfkm)
Messenger RNA biogenesis [BR:acs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100552812 (pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 100552812
NCBI-ProteinID: XP_003227876
Ensembl: ENSACAG00000005562
UniProt: H9GAR9
LinkDB All DBs
Position
Un
AA seq 782 aa AA seqDB search
MAHVPGKHEHADTMGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVFFVHEGYQGL
VDGGDNIREATWESVSMMLQLGGTVIGSARCKDFRDREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSGLLQDLVKTGGITAEEAKNSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTALASGADWVFIPESPPEDD
WEEHLCRRLTETRNRGSRLNIIIVAEGAIDKHGKPITSEDIKSLVVKRLGYDTRVTILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAIRLPLMECVQVTKDV
TTAMNEGRFDESLKLRGRSFQNNWNVYKILAHVHPPTAKSGYNLAVMNVGAPAAGMNAAV
RSTVRIGLIHGHRMLAVHDGFEGLAEGKVEEIGWSGVGGWTGRGGSSLGTKRTLPKKYFE
EISNTIANFNIHGLIVIGGFEAFTGSLELIEGRAKFEELCIPICVIPATVSNNIPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDP
FTIRDLELNVSHLTEKMKTTVKRGLILRNEKCNENYTTEFIFNLYSEEGKGIFDTRKNVL
GHMQQGGSPTPFDRNFGTKMGAKAVAWMSGKIKECSRHGRIFANTADSACLLGMRRRALV
FQPLIELKQETDFEHRIPKTQWWLKLRPILKILAKYKIDLDTSETAHLEHITRKRVSGEG
AL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgttccgggaaaacatgaacatgctgacactatggggatcggcaaggctatt
gccgtgttgacatctggaggagatgcccagggcatgaatgctgctgtccgggctgtagtc
cgagtgggtatatacactggtgccaaagtgttcttcgttcatgagggctaccaaggtctt
gtggatggtggtgacaatattagggaagcaacatgggagagtgtttctatgatgctgcaa
ctgggtggcacagtgatcgggagtgccaggtgcaaggatttccgtgatcgtgaaggacga
ttgaaagctgcacgcaatctagtaaaaagaggaatcacaaacctgtgtgtgattggaggc
gatggcagtttgaccggagcagacaccttccgagcagaatggagtggtttgctgcaggat
ctggttaagacaggtggtatcacagcagaagaagcaaagaactccagtcacctgaacatt
gttggcatggttggctctattgataatgacttttgtggtactgacatgaccattggcaca
gactcagccctccataggataatggagatagtagatgctatcaccaccactgctcaaagc
catcagaggacctttgtgctggaggtgatgggtcgtcactgtggttatctagcccttgta
acagctttggcaagtggagcagactgggttttcattccagaatctccaccagaggatgat
tgggaggaacacttatgcaggaggttaacagagacaagaaatcgaggttcacgactgaac
atcatcattgtagctgaaggagccatcgacaagcatggcaagcccatcacttcagaggac
attaagagtctggttgtgaaacgcctgggctatgacacaagagtcaccatccttggacat
gtgcagcgcggtgggaccccctctgcctttgatcgtatcctgggaagcaggatgggcgtg
gaagccgtcatggccttactagaaggaaccccagataccccagcatgtgttgtcagcctt
tcgggtaaccaagccattcgccttcctctcatggagtgtgtccaagtgacaaaggatgtc
acaacagcaatgaatgaaggacggtttgatgaatctcttaaacttagaggaaggagtttc
cagaataactggaatgtttacaagatcttggctcatgtgcacccacccactgcaaagagt
ggctacaatttggcggtgatgaatgtgggggcaccagcagctggcatgaatgcagccgtg
aggtctactgttagaatcggattgatccatggccacaggatgctggctgtgcatgatggg
tttgaaggccttgctgaaggaaaggttgaagaaattggatggagtggagttggtggctgg
actggaaggggtggatcaagccttggaacgaaaaggacactgcccaagaaatactttgag
gaaatcagcaacacaattgccaattttaatattcatggcctgatcgtcattggtggcttt
gaggctttcactggcagcctggaattgattgaaggccgagccaagtttgaagagctctgc
atcccaatctgtgtgatccctgccaccgtctctaacaacattcctggctctgacttcagc
attggggcagacacagccctcaacaccatcacgtcgacttgtgaccgtatcaagcagtct
gcagctggcaccaagaggcgggtgttcatcattgagaccatgggtggctactgtggctat
ctggctaccatggcaggtttggctgctggagctgatgcagcctacatttatgaagatcct
ttcactatccgtgacctggagttaaatgtgtcacatctgactgaaaaaatgaagaccaca
gtgaagagaggtctgatattgaggaatgagaaatgtaatgaaaactataccactgagttc
atattcaacttgtattctgaggagggaaaaggcatctttgacaccaggaagaatgttttg
ggacacatgcaacagggtggatcgccaactccatttgacaggaactttgggacgaaaatg
ggtgccaaagccgtggcatggatgtctggcaagatcaaagaatgctccagacatggccgt
atttttgccaacactgccgattcagcttgcctcttgggcatgcgcagacgggcacttgtt
ttccagcctctcattgaacttaaacaagagacagattttgagcaccgcatccccaagact
cagtggtggctgaagcttcgtcccatcttgaagattcttgccaaatacaagatcgacttg
gatacctcagagacagcccacctagagcatatcacccgcaagagagtatcaggtgaaggc
gctctgtga

DBGET integrated database retrieval system