KEGG   Anolis carolinensis (green anole): 100552870Help
Entry
100552870         CDS       T01608                                 

Gene name
pten
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04115  p53 signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04218  Cellular senescence
acs04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100552870 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100552870 (pten)
   04070 Phosphatidylinositol signaling system
    100552870 (pten)
   04150 mTOR signaling pathway
    100552870 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100552870 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100552870 (pten)
   04218 Cellular senescence
    100552870 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100552870 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100552870 (pten)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100552870 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     100552870 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100552870 (pten)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100552870 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100552870
NCBI-ProteinID: XP_003224419
Ensembl: ENSACAG00000015101
UniProt: H9GLY0
LinkDB All DBs
Position
Un
AA seq 404 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGNHVA
AIHCKAGKGRTGVMICAYLLHRGRFHKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSTSGPTRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKEKMFHFWVNTFFIPGLEENSDKVENGSLLGDPE
LDGIFSTERSDNDKEYLILTLTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNPEA
SSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaagagatcgtcagcaggaacaaaaggcgataccaggaggatggc
ttcgatctagacctgacctatatttatccaaatatcattgcaatgggttttcctgcagaa
cgacttgaaggagtatacagaaacaatattgatgacgttgtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaacgacattatgataccgccaaa
tttaactgcagagttgcacaatatccctttgaagaccataaccctccacagctggagctt
atcaaacctttttgtgaagatcttgatcgatggcttagtgaagatggcaatcatgttgca
gcaatccactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttgtta
catcgaggaagatttcataaggcacaagaagccctagatttctatggtgaagtaaggacc
agagataaaaagggagtaactattcccagtcagaggcgctatgtatattactatagctac
ctgttaaagaatcatctggattaccgaccagtggcactgctctttcacaaaatgatgttt
gaaacaattccaatgttcagtggtggcacctgcaatcctcaatttgtggtctaccagctc
aaggtaaagatattcacctctacttcagggcccacaaggcgtgaagacaaatacatgtac
ttcgaattccctcagccattgccagtgtgtggtgacatcaaagtggaattcttccataag
caaaacaagatgttgaaaaaggaaaaaatgtttcatttctgggtaaatacattcttcata
ccaggactggaagaaaattctgacaaagtagaaaatggaagtcttcttggggacccggaa
cttgatgggattttcagtacagagcgttcagataatgacaaggaatatctaatacttaca
ctaacaaaaaatgatttggacaaggcaaataaagacaaagcaaatcgttacttttctcca
aactttaaggtgaagctatttttcacgaaaacagtagaggagccatcaaacccagaagca
agcagctcaacttcagtaacaccggatgttagtgataatgaacctgatcattataggtat
tctgacaccactgactctgatccagagaatgaaccttttgatgaagatcagcatacacag
attacaaaagtctga

DBGET integrated database retrieval system