KEGG   Anolis carolinensis (green anole): 100552886Help
Entry
100552886         CDS       T01608                                 

Gene name
tgm2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100552886 (tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core TIG
Motif
Other DBs
NCBI-GeneID: 100552886
NCBI-ProteinID: XP_008119776
Ensembl: ENSACAG00000013226
LinkDB All DBs
Position
Un
AA seq 689 aa AA seqDB search
MAEALQLETWDLLYEHNNEDHRTADAGFQRLLVRRGQSFIVTLHFSGRSFDEAVDTLTFH
VETGPCPIETSGTKSSFPLSCSLEETVWSSAVEGQDGSSLTLFVFPPPDARIGRYRLTVD
VSTEGQGSSFDLGEFVLLFNPWSPDDTVYMESEEACVEYVLTQHGHIYQGSKDFIYSIPW
NFGQFEEGIVDICLQLLDTNPKFLRNQDKDCSRRNNPVYVSRVISAMVNCNDDQGILFGR
WDNKYDDGVSPMAWSGSVDILQRWQKFGCQPVRYGQCWVFAAVACTALVCLGHPPGRVVP
NYNSAPQHPWEPWSIEQYLEQSGKLQQGDRELIWNYHCWVEAWMARPDLSEGYDGWQVLD
PTPQEKSEGVFCCGPTPVKAVKEGDLHLKYDVRFVFAEVNADVAYLMLQKDMSRKKTTIT
TTVGKNISTKSVGRDSKEDITHHYKYPEDSEEERAVFEKAQLHKDPPPAEEGLKVKIKAS
EGMNNGCDFDVFALLTNNTAEEHRCRLMFGARTLSYNGALGPECGSKDLLNITLEPHAER
TVPLRILYEKYGHCLTQDNMIKVMALLVDLDTQEAVLGVRNIYVKNPDIKVRVLGEPMQK
RKLVAELTLTNPLPTPLTGCVFTVEGAGLTDRQKVQEIDSPISPGEEAKVRVDFVPRQSG
LRKLVVDFESDKLKGVKGYRNVIIAPLPK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctctgcaattggagacgtgggacctgctctacgagcacaacaacgaggac
caccggaccgccgacgccggtttccagaggcttcttgtgcgccggggccagtccttcatt
gtgacgctccacttctctggaaggtcctttgacgaagcagtggacaccctcaccttccac
gtcgagacaggtccttgccccattgagacatctgggaccaagtcctccttccccctctct
tgctccctggaagagaccgtctggagctctgctgtggaaggccaggatgggtcctccctg
accctcttcgtcttccctcctccggatgcccgcatcggccgctaccgcctgaccgtagac
gtctccacagaaggccaaggatccagcttcgacctgggagagttcgtcctgctcttcaat
ccctggtccccagatgacactgtctacatggagagcgaagaggcctgcgtcgagtatgtc
ctgacccaacatggacacatctaccaaggatccaaggacttcatctattccatcccttgg
aacttcgggcagtttgaagaagggattgtggacatctgcctccaactgctggacaccaac
cccaaattcctccgcaaccaggacaaggactgctcccgccgcaacaaccccgtctacgtc
agccgagtgatcagcgccatggtgaattgcaatgacgaccaaggcatcctctttggacga
tgggacaacaagtacgacgacggcgtgagtcccatggcctggagtggtagcgtggacatc
cttcagaggtggcagaagtttgggtgccaacctgtccgttatgggcaatgttgggtcttt
gcagccgtggcttgcacagctctcgtatgcctggggcatccccctggccgggtggtcccc
aactacaactctgccccacaacacccatgggaaccttggtccatcgagcaatacctggag
cagagcggcaagcttcagcagggcgaccgagagctcatctggaattaccactgctgggtc
gaggcttggatggcacgtccagatctttcagaaggatacgatggatggcaggttttggac
ccaacgccccaggagaaaagtgaaggtgttttctgctgtggcccaacgcctgtcaaagct
gtcaaggaaggagacctccatctgaagtatgacgtccggtttgtctttgctgaggtcaac
gccgatgtggcatatttgatgctccagaaagacatgtcccggaagaagaccaccatcacc
accacggtgggcaagaacatcagcaccaagagcgtgggcagggactccaaggaggacatc
actcatcattacaaataccccgaagactcagaggaagagcgagccgtgttcgaaaaagcc
cagctccacaaagacccaccaccagccgaggaaggactaaaagtcaagatcaaagcctcc
gagggcatgaacaacggctgtgacttcgacgtcttcgccctcctcaccaacaacacggct
gaggagcaccggtgccgcttgatgttcggggccaggaccctcagctacaacggggctctg
ggtcctgagtgtggctccaaagacctgctgaacatcacgttggagccacatgcagagcgg
accgtccctttgcgcatcctctatgagaagtacggccactgcttgactcaggacaacatg
atcaaggtgatggccctcctcgtggacctcgacacccaggaggccgtccttggggtccgg
aacatctacgtcaagaacccggatatcaaagtcagggtcctgggggagccgatgcagaag
cggaagctggtggccgaactgacgctgaccaacccactgcccacccctctgaccggctgc
gtcttcaccgtggaaggggccggactcacagatagacagaaggtccaggagatcgattcc
ccaatcagtccgggtgaagaagccaaagtgagggtggacttcgttccccgccagtctggc
ttgcggaagctggtggtggacttcgaaagcgacaagctgaaaggggtgaagggctaccgg
aacgtcatcatcgctcctttgcccaagtga

DBGET integrated database retrieval system