KEGG   Anolis carolinensis (green anole): 100552899
Entry
100552899         CDS       T01608                                 

Gene name
tgfbr2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04060  Cytokine-cytokine receptor interaction
acs04068  FoxO signaling pathway
acs04144  Endocytosis
acs04218  Cellular senescence
acs04350  TGF-beta signaling pathway
acs04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100552899 (tgfbr2)
   04350 TGF-beta signaling pathway
    100552899 (tgfbr2)
   04068 FoxO signaling pathway
    100552899 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100552899 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100552899 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    100552899 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100552899 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100552899 (tgfbr2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100552899 (tgfbr2)
Protein kinases [BR:acs01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100552899 (tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 100552899
NCBI-ProteinID: XP_016853593
Ensembl: ENSACAG00000014301
LinkDB
Position
1
AA seq 554 aa
MDGHLWREKSIFHLFFLFPDEDHLSKLLNGKIKFPTLCKFCDVKLTNCKNEGQCKSHCNL
TSICEKKTEVCAAVWRKNDENITLETICHDPSQKLHGHELTDYNSKKCIMSERRETGGLL
YMCSCDEEECNDVLIFSPENSPTERVIDVISKVALISLVPLLVSAIAVSFIFYCYRIQRR
RKLNKAWEKNVKSRKRKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDTLVGKG
RFAEVYKAKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENILQFLTAEER
KTDLGKQYWLITAFHSRGNLQEYLIKHVISWEDLWKLGGSLARGIAHLHSDHTPCGRPKT
PIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESR
MNLDNVESFKQTDVYSMALVLWELTSRCNGVGEVKDYEPPFGSKVREHPCVESMKDNVLR
DRGRPEIPNSWLNHQGIQKVCETLVECWDHDPEARLTAQCVAERFNDFEYQDTLSGRSSS
EEKIPEEVSVNSAN
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggatggacacttgtggagggaaaaatctatatttcatctttttttcttatttccagat
gaagatcatttatccaaactgttgaatgggaaaatcaagtttccaacactttgcaaattt
tgtgatgtgaaattaacaaactgcaaaaatgaaggccagtgcaagagtcactgcaacctc
acatctatttgcgaaaaaaaaactgaagtatgtgcagctgtttggagaaaaaatgatgaa
aacataacattggaaacaatatgtcatgatccatcgcaaaagctccatgggcatgaattg
acagactacaattcaaagaaatgtataatgtcagagaggagggaaactggagggttgctt
tatatgtgctcctgcgatgaggaggaatgcaatgatgtacttattttttctccagaaaac
tcaccaacagagagagtgatagatgtgatatctaaagttgcactaataagcctcgttcca
ttgcttgtgagtgccattgctgtgagctttatcttctactgctaccgtattcagaggagg
aggaagctgaacaaggcatgggagaaaaatgtgaaatccaggaaacgtaaagactgtagc
gatgtgtgtgccattatgttagatgatgaccgctctgatattagttcgacttgtgccaat
aacataaaccataatacggaactgttgcccattgaactggataccctggtgggcaaaggg
cgctttgctgaagtctataaggctaaattgaaacagaacacatcagagcaatttgagaca
gtggctgtcaagatcttttcctatgaagaatatgcatcctggaagaccgagaaggatata
ttctccgatataaatctgaaacatgagaacatcctccagttcctcacagcagaagagcgc
aagacggatctaggcaagcaatactggttgatcactgctttccactcaaggggcaatttg
caggaatacctcataaaacacgtaattagctgggaagacctctggaaattgggtggatct
ttggctcgagggattgcccatctccacagtgaccatacaccctgtggccgccccaaaaca
cctattgtacacagggacctgaagagctccaatatcttggtgaaaaatgacttaacctgc
tgcctctgtgattttggactttcattgaggctggatcctactctttctgtagatgaccta
gccaacagtggtcaggtcggcactgcaagatacatggctcctgaagtcctggaatcacga
atgaatttggataatgttgaatccttcaagcagacagatgtgtattccatggccttagtt
ctatgggaactgacatcccgttgcaatggtgttggagaggtcaaagactatgagccccca
tttggttctaaagtgagagaacatccttgcgtggaaagcatgaaggacaacgttttgagg
gacagagggcgaccagagattcctaactcatggctcaaccatcagggcatccagaaagtc
tgtgagactcttgtggagtgctgggaccatgaccctgaagcccggctcactgctcagtgc
gtagctgagcggttcaatgattttgaataccaggacacactttcaggaagaagcagctct
gaagagaagatccctgaggaggtctctgtgaacagtgccaactaa

DBGET integrated database retrieval system