KEGG   Anolis carolinensis (green anole): 100553015Help
Entry
100553015         CDS       T01608                                 

Definition
(RefSeq) uncharacterized LOC100553015
  KO
K06751  MHC class I antigen
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04144  Endocytosis
acs04145  Phagosome
acs04218  Cellular senescence
acs04514  Cell adhesion molecules (CAMs)
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100553015
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100553015
   04145 Phagosome
    100553015
  09143 Cell growth and death
   04218 Cellular senescence
    100553015
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100553015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100553015
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:acs00537]
    100553015
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100553015
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:acs00537]
 Antigens
  100553015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 MHC_I_2
Motif
Other DBs
NCBI-GeneID: 100553015
NCBI-ProteinID: XP_003227797
LinkDB All DBs
Position
Un
AA seq 731 aa AA seqDB search
MSPVSGLFPLLLGAIVSPFGCSAHSGRSHRLHYFFTGVSEPGGGLPHFSIVGYLDDEQFV
RYDSETRRDLPRSSWIRKMEEHDAQYWDWQTQLSRSWELYFRVSLWTRFNHSRGHHTWQW
MHGCEVSADGRKGGLSQFGYDGRDFLSLDKETLTWTASNPKAQVTKRKWEADRVWTQGRK
TFLEEDCIDWLHKYLNYGKETLLRKESPVVKVTRKAGYGDLETLLCRAHGFYPKEIDITW
RMEGNVMEQETRRGGIAPNADGTYHTWLSIEVDTKDRDLYRCHVEHDSLPEPLDAAWEEA
GVLWPLVAGISGAVAVVILLGVILVLYLKRRHEGYRATAFSLSLCNARCRNGEIFFFLLV
EFIPSRPIGFVGLGGRCGADSPGPAMGAFRGLFFFFLFFPGTLAGSFSHSMRGFYTATWD
PSQAQPQVAIVIYVDDQLATQYNSSTRQALPQVYWMEKMDEHIPSFWEVNTLKGQRLELR
LKKTLENLKERSNQSTGFLTFQLMTGCEIRKNGHKEGYHQYSYNGRDFLSFDPKTQTWTA
ADLEAQITQRQWDGDVDYSRHVMYYVEEECPEDLQRFVEYGKESLLRRETPVVTISRKAY
YDGLETLLCRVHGFYPKEIDVNWKRDGEVWVQDTFSGGILPNADGTYHTWISIEVEPKER
DRYRCHVEHDSLEEPLVLAWEDRGSVWPLVGGVLGAVVGVLLVAAGIILYKKKGQEATEE
EPQVEDPLMNG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgtttctgggctgtttccgctccttttgggagccatagtctcccccttcgga
tgctccgctcattctggtcggagccatcgtttgcactatttcttcacgggggtctctgag
cccggcggggggctgccccacttcagcatcgtaggctacctggatgacgagcagttcgtc
cgctatgacagcgaaacgcggagggatctgccgcggtcctcctggatccggaaaatggag
gagcacgatgcccaatactgggactggcagacacaactctcccggagctgggagctctac
ttccgagtcagtctctggacccgcttcaaccacagtcgcgggcatcacacctggcagtgg
atgcacggctgcgaagtgagtgcggacggccgcaaagggggcctctcccagttcggctac
gacgggagggacttcctcagcctggacaaggagaccctcacctggacggcctccaacccc
aaggcccaggtgaccaagcggaagtgggaggcggaccgcgtttggacccaggggcgcaag
accttcctggaggaggactgcatcgactggctgcacaagtacctcaattacgggaaggag
acgctgctccggaaagagtctccggtggtgaaggtgacgcgaaaggccggctacggagac
ctggagacccttctgtgtcgggcccacggcttctaccccaaggagatcgatatcacctgg
aggatggaggggaacgtcatggaacaggagacccgccgcgggggtattgctcccaatgct
gatggcacctaccacacctggctgagtattgaggtcgacaccaaggatcgggacctttac
cggtgccatgtggagcatgatagcctcccagaacctctggatgcagcgtgggaggaggcc
ggtgtcctatggcccctcgtggccggcatctcaggcgccgtggctgttgtcatcctcctt
ggggtcatcctcgtcctctacctcaaaagacggcacgagggatacagagcaacagcattt
tcgctttcgctttgcaatgcccgatgtcgcaacggtgagatcttttttttcctattggtg
gaatttattccctcccgaccaatcgggttcgtgggactgggagggcgttgcggggcagac
tctccgggtccagccatgggcgcctttcgggggctgtttttcttcttcctcttcttcccg
gggacccttgcaggttccttctctcactccatgcgtggcttttacaccgcaacgtgggat
cccagccaagcgcagccccaggttgccattgtgatctatgtggacgaccagcttgcaact
caatacaacagcagcaccaggcaggccctgccccaggtctactggatggagaagatggat
gagcacattccttccttctgggaagttaatacactcaaaggacagagacttgagctgaga
ttgaaaaagacactggagaacctgaaagagcgctccaaccaaagcacaggttttctcacc
ttccagttaatgaccggttgtgagataaggaaaaatggccacaaggagggctaccaccag
tacagctataatgggagagacttcctgagctttgacccaaagacccagacctggacggct
gctgacctggaagcccaaattacccagaggcagtgggatggtgacgtggactattcgcgg
catgtgatgtactacgtggaggaggaatgcccagaggacctccagagatttgtggagtat
gggaaggagtctctgctaaggagagagactccagtggtgaccatttctcgcaaagcttat
tacgacgggctggagaccctcctctgccgagttcacggcttctaccccaaggagattgat
gtcaactggaagagggacggggaagtctgggtgcaagacaccttcagtggtgggatcctc
cccaacgcagatgggacctaccacacctggatcagcatcgaggttgaacccaaagagagg
gaccgctatcggtgccacgtggagcacgacagcctggaggagcccctggtcttggcctgg
gaggatcgcggttctgtatggcccctcgttggaggcgtccttggtgccgttgttggtgtc
ctgctggtggctgctgggatcattctctacaaaaaaaaaggccaggaggcaactgaggaa
gagcctcaagtggaagaccctctgatgaatggatga

DBGET integrated database retrieval system