KEGG   Anolis carolinensis (green anole): 100553244
Entry
100553244         CDS       T01608                                 

Gene name
cacna1c
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04020  Calcium signaling pathway
acs04260  Cardiac muscle contraction
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100553244 (cacna1c)
   04020 Calcium signaling pathway
    100553244 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100553244 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100553244 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    100553244 (cacna1c)
   04270 Vascular smooth muscle contraction
    100553244 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    100553244 (cacna1c)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100553244 (cacna1c)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100553244
NCBI-ProteinID: XP_016849102
Ensembl: ENSACAG00000011077
LinkDB
Position
5
AA seq 2222 aa
MFQSLVRHATSAYRPLPTHLPGEPGAKYTGKMVHETQLSCFYSPPGGSNYVSPRPGHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGAAGNATISTASSTQRKRQQYGKQK
KQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGVNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYVTGVITDAPAEEEPSPCAPAFAHGRQCQNGT
DCRPGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGREWPWIYFVTLII
IGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTDNVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSSVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEPEKLAVERETKEEKIELKSIT
ADGESPPSNKSNIDEYQPNENEEKNPYPTTEAPGEEEEEEEPEMPVGPRPRPMSELHLKE
KAVPMPEATAFFVFSPSNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHYSVR
NQILFYFDIFFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYF
NILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTI
GNIVIVTTLLQFMFACIGVQLFKGKLYSCSDSSKQTETDCKGSFITYKDGEVSQPMIQPR
KWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIY
IIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQ
YKVWYVVNSTYFEYLMFILILLNTICLAMQHYGQSCLFKEAMNILNMLFTGLFTVEMVLK
LIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAIT
EVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALP
YVALLIVMLFFIYAVIGMQVFGKIALDDTTDINRNNNFQTFPQAVLLLFRCATGEAWQEI
MLACLPEKKCDMDSFEPNNSVEGEHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFD
YLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVAC
KRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKL
LDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHD
IGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSSFPQ
TFTTQRPLHINKSGNNQGDIESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALSRFSS
PPNYPSTVSTVEGHNTPLSPAARIHDASWKLGCRRTCYYETVGRSCSRDSQVAIVCEEEA
SLEEEMYDKQLNEGAEYCSEPSLLPSELLSYQDDEHRQLTPSEDNKWKDSQHSPKSGLLH
SLSLSRKASFHLECLKKHKTQNAEVPQKTVLPLHLVHHQALAVAGLSPLQRSHSPLRYSR
SCGTPPAAFCAQDWPQQPIQTLQPEGEESDEKLNNSFPSIYCSSLYSDSPSASSTRKARP
VSLTVPSHTGDCGRQFHGSANSLVEAVLISEGLMRFAQDPKFIEVTTQELADACDLTIEE
MENAADNILSGNSKPSPNGNLLPFVNCRDPGQDCLGEEAAQNPDCRKSQEEPKDSRIYIS
SL
NT seq 6669 nt   +upstreamnt  +downstreamnt
atgtttcagagcctggttcggcatgcgacctcagcgtatcgaccgctccccacgcacctg
ccaggggagccaggagcaaagtataccggcaagatggtccatgaaacccaactcagctgc
ttctatagtccacctggaggttccaactatgtgagtcctcgtccaggtcatgccaacatg
aatgccaatgcagctgcagggcttgcacctgagcatatccctactccaggtgcagccctc
tcttggcaggctgccatcgatgctgccaggcaggccaaattgatgggtgctgctggcaat
gcgacaatatccactgctagctcaacgcagaggaagcggcagcagtatgggaaacagaaa
aaacagggtactaccacagctacacgtcctccccgggcattgctgtgtttaacactgaaa
aatcccattcggagggcatgtatcagtattgttgaatggaaaccatttgaaatcattatt
ttactgactatttttgccaattgtgtggccttagctatctatatcccttttccagaagat
gactccaatgctactaattccaatctggaacgagtggaatatctctttctcataattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccctaacgcttac
ctccgcaatggctggaatttattagattttataattgtggtagtaggactttttagtgca
attttagaacaagcaaccaaagcagatggggtaaattcaataggaggcaaaggcgccgga
tttgacgttaaagcacttcgggctttccgagtattacgccccttacggctggtatctgga
gttcctagcctccaggtggttttaaattccattatcaaggccatggtccctttgctgcac
attgccctgctggtgctgtttgtcataattatctatgctatcatcggactggagcttttc
atgggcaaaatgcacaagacctgttatgtaactggggtcataacagatgcacctgcagaa
gaggaaccttctccttgtgcgcctgcatttgcacatgggcggcaatgtcagaatggtact
gactgcagaccaggatgggaggggccaaaacatggcattaccaactttgacaactttgcc
tttgccatgttaactgtgtttcagtgcatcaccatggagggctggacagatgtactgtac
tgggtcaatgatgccataggaagggagtggccctggatctattttgttactctaatcatc
atagggtcattttttgtacttaacttggttctcggtgtacttagcggggagttttctaaa
gaaagagagaaagcaaaagctcggggtgactttcaaaagttaagagagaagcagcagctg
gaggaggacttgaagggatatctggattggataactcaagcagaagacattgatccagaa
aatgaagatgaaggcatggatgaggagaagcccagaaacatgagcatgcctaccagtgag
acagaatctgtgaacacagataatgtagctggaggtgatattgaaggagaaaactgtggt
gcacggctggcgcaccggatatcgaaatctaagtttagccgctactggcgcagatggaat
cggttctgcagacggaaatgtcgagctgctgtcaaatccagtgtgttctactggcttgtg
atcttccttgtttttctcaatactctcaccattgcctctgaacattacaaccaaccagac
tggctcactgaagtccaagacactgccaataaggtactgctggctcttttcacggctgag
atgctactaaagatgtacagcctgggtcttcaggcatactttgtgtcactcttcaaccgc
tttgactgtttcattgtctgtggtggtatcctggagaccatattggtggaaacaaagatc
atgtcacccctgggtatctcggtgctgagatgtgtacgactactgaggatctttaaaatc
acaagatactggaattccttgagtaacttggtggcttccctactcaactctgttcgttcc
attgcctccctcctcctgctcctcttcctcttcatcatcatcttctcccttctagggatg
cagctctttggggggaaatttaattttgatgagatgcaaaccaggagaagcacatttgat
aattttccccagtctctgctcactgtgtttcagatcctgactggggaggactggaattcg
gtgatgtatgatggaatcatggcttatggcggcccctcttttccaggaatgttggtctgt
atttacttcatcatcctcttcatttgtggaaactatattttgctgaatgtctttttggcc
attgcagtggacaatcttgctgatgctgaaagcttaacatctgctcagaaagaagaggag
gaggaaaaggaaagaaaaaaattagctaggactgctagtcctgaaaagaagcaagagcct
gagaagctggctgtggagagagagacaaaggaggaaaaaatagagctgaaatcaatcact
gctgatggagagtctccaccttctaacaagagcaatatagatgaatatcagcctaatgaa
aatgaagaaaagaatccctatcctactacagaggcaccaggagaggaagaagaagaagaa
gagcctgagatgccagttgggccccgcccacgcccaatgtctgaacttcacctgaaggaa
aaagctgtaccaatgccagaagccactgcttttttcgtattcagcccgagtaacagattt
cgggttcactgccatcgcattgttaatgataacattttcaccaacctgatcctctttttc
atcttgctcagcagcatctctctggcagctgaagatccagttcgacattactccgttaga
aatcaaattctcttttattttgatatattttttactgtcattttcaccattgaaattgct
ctgaagatcctaggcaatgcagattatgtcttcactagtatctttacattagaaattatt
cttaagatgactgcttatggggctttcctccacaaaggctctttctgcagaaactacttc
aacatcttggacctgctggtggttagcgtttctctcatctcctttgggatccaatctagt
gccatcaatgttgtgaagatattacgagtcctgagagtgctcagaccactaagggccatc
aacagagccaaaggcttaaagcatgtagtccagtgcgtatttgtagccatccgaactata
gggaacattgtgattgtcaccacattactacagttcatgtttgcctgcataggggttcag
ttgttcaagggcaaactgtacagctgcagtgatagttccaagcagacagagacagactgc
aagggaagttttataacttacaaggatggagaggtatcacaaccaatgatccagcctcga
aaatgggagaacagtaaatttgattttgataatgtcctcactgccatgatggccctcttc
actgtttcaacctttgaaggttggccagaactgctgtaccgatccattgattcccatatg
gaagatgtgggccctatctataaccacagggtggagatctcaattttctttattatctac
atcattatcatcgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcactttt
caggagcaaggagaacaagagtacaagaactgtgagctggataagaaccagcgtcaatgt
gtagaatatgccttaaaggcccgtccccttcgaaggtacattcccaaaaaccagtaccag
tataaagtgtggtatgtggtgaactccacctattttgaatacctgatgttcatcctcatc
ctgttgaacactatctgcctcgctatgcagcactatggtcagagctgcctcttcaaagaa
gcaatgaacattctcaatatgctcttcactggcctcttcaccgttgagatggttctgaaa
ttaattgccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctc
atcgtaattggcagcattatagacgtcattctcagtgaaactaatcactatttctgtgat
gcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcacc
gaggtgaacccagctgaacatacccaatgctcttcctctatgaacgcagaggaaaactct
cgcatctcaatcacgtttttccgactcttccgtgtgatgcgtctggtgaagctcttgagc
cgaggggagggcatccgcacgctactgtggaccttcatcaagtccttccaggctctccct
tatgtggctcttttaatagtgatgctgttttttatctatgctgttattggtatgcaggtg
tttggtaaaattgccctggatgataccacagatatcaatcggaacaacaattttcaaact
ttccctcaggcagtcctgctgcttttcagatgtgcaacgggtgaagcttggcaagaaatc
atgttggcatgtctcccagagaagaaatgtgacatggactcttttgaacccaacaactct
gttgaaggcgaacattcctgcggaagcagctttgctgttttttatttcatcagcttttat
atgctttgtgccttcttaatcattaacctttttgtagctgttatcatggataattttgat
tacttaacaagggattggtcaattctgggcccccatcatctggatgaatttaaaaggatt
tgggcagagtatgatcctgaagctaaaggacgtattaaacaccttgatgtggtgacactc
ctgcgtcgaatacaacctccattaggttttggaaaactctgtcctcaccgagtagcttgc
aagcgcctcgtctccatgaatatgccactcaatagtgatgggacggttatgtttaatgca
actttatttgccttggtcagaacagcattgaggatcaaaacagaaggtaacttggagcaa
gccaatgaagagctgcgtgcaattattaagaaaatctggaagcgaactagcatgaaactg
ttggatcaggttgtgcccccagcaggtgatgatgaagtaactgttggaaagttctatgcc
acattcctgattcaagagtatttccggaaatttaagaaacgcaaagaacaaggccttgtt
ggtaaaccttcacaacggaatgctctatctcttcaggctggtttgcgaacattacatgac
attggaccagaaattcgaagggcaatctctggagatttaacagcagaagaggaattagac
aaggccatgaaagaagctgtttcagctgcctctgaagatgacatcttcagaagagctggt
ggcttgtttggaaatcatgttagctattaccaaagtgatggcagaagttcattcccccaa
accttcactactcagcgtcctttgcacatcaacaaatctggcaacaatcagggagacata
gaatctccatcccatgaaaagcttgtggattctaccttcaccccaagcagctattcatca
tcaggctccaatgctaacatcaacaatgccaacaacactgctctgagccgcttttccagt
ccaccaaactaccccagcactgtcagcactgtggaaggccacaatacgcctttgtcacct
gcagcaagaattcatgatgcttcttggaaacttggctgtagacgaacatgctattatgaa
acagtggggcgatcatgttccagagacagtcaggtggctattgtttgtgaggaggaggct
tctctggaggaggaaatgtatgataagcaactgaatgaaggagctgagtactgcagtgaa
ccaagtctgctgcctagtgaattgctctcataccaagatgacgaacatagacagctaact
ccatctgaagacaacaaatggaaagactctcaacactctccaaagagtggactcctacat
tccttatccctaagtcgaaaagcatcttttcatctggagtgtctaaaaaaacataaaact
cagaatgcagaagtcccacagaagacagtactacccttgcatttggtacatcatcaggca
ctagcagttgcaggtttgagtcctcttcaaagaagccattctcctctacggtattctcga
tcatgtggcacacctcctgctgcattctgtgcacaggattggccgcaacaacctattcaa
acactgcaacctgaaggagaggagtctgatgagaagctcaataacagtttcccatcgata
tattgcagctccttatactctgatagccccagcgctagcagtacgcgaaaagctaggccg
gtatccctcacagttcccagccatactggagattgtggcagacaatttcatggcagtgct
aacagccttgttgaagcggtcttgatttcagaaggactcatgcggtttgctcaagatcca
aagttcattgaggtcacaactcaagaactagctgatgcctgtgacttgacaatagaagaa
atggagaatgctgcagacaacattctcagtggtaacagcaagccaagccccaatggcaac
ctcttgccttttgttaattgcagggacccagggcaggactgtttgggagaggaagcagcc
caaaacccagattgtagaaaaagccaagaggagcctaaggacagcaggatttatatcagc
agcttgtag

DBGET integrated database retrieval system