KEGG   Anolis carolinensis (green anole): 100553527
Entry
100553527         CDS       T01608                                 

Gene name
ccne1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100553527 (ccne1)
   04114 Oocyte meiosis
    100553527 (ccne1)
   04115 p53 signaling pathway
    100553527 (ccne1)
   04218 Cellular senescence
    100553527 (ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100553527 (ccne1)
   03036 Chromosome and associated proteins [BR:acs03036]
    100553527 (ccne1)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100553527 (ccne1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100553527 (ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100553527
NCBI-ProteinID: XP_003225481
Ensembl: ENSACAG00000014781
LinkDB
Position
Un
AA seq 397 aa
MPSESDHQDKSAAIHEGGAPDFAVRSRKRKADVVIFLPDPDEDVAGIQMMKKKQNECQPS
SNLPHTLIPTPDKEELRSPKFSSIHKSLTAARDSPLPVLGWGNRDEVWKNMIKKEQTYVR
DKLYMQRHPLLQPKMRVILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATHQNVVKTLLQ
LIGISSLFIAAKREEIYPPKLCQFAYVTDGACTEEEILNMELLIMKALDWHLSPLTVVSW
LNIYLQIAYLNEIYEMLLPHYPQQIFVQIAMLLDLCVLDIGCLGYTYSVLAASALYHFSS
CELMQRVSGYEFSDIEDCVKWMVPFAMVIKEVGSTTMKQFRGVPAEDLHNIQTHINTFDL
LDKVESKQASLAEKSRHSPLPPGILTPPQSSKKLPQL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgcccagcgaaagtgatcaccaggataaaagtgctgctattcatgaaggaggggctcct
gactttgctgttagatcccgcaaacgaaaagctgatgttgtaatatttttaccagatcca
gatgaagatgttgctggaatacaaatgatgaagaagaagcagaatgaatgtcagccatct
tcgaatctgccccatacactgatcccaacaccagacaaagaagagctgaggagccccaaa
ttctcttccattcacaaaagccttactgcagctagagattcaccattgcctgttttgggc
tggggaaatagagatgaagtatggaaaaacatgatcaaaaaagagcagacgtatgtgaga
gacaagctatatatgcaacggcacccactcttacaaccaaaaatgcgggtcattcttcta
gactggctaatggaggtgtgtgaagtctacaaacttcacagggagacattttatttggca
caagatttctttgaccggtacatggcaacgcatcagaatgttgtaaagacgcttctacaa
ctaattggcatttcatccttatttatagctgcaaaacgtgaggagatctatcctccgaaa
ctgtgtcagtttgcatacgttacagatggagcttgcacagaagaagaaattcttaatatg
gaactcctcataatgaaggccctcgactggcatttgagccccctcaccgttgtgtcctgg
ctcaacatatacttgcaaatcgcatatctaaatgagatctacgagatgctgcttccgcat
tatccacagcagatatttgtgcaaatagccatgcttttggatctctgtgtcctggatatt
ggctgtctgggatatacatatagcgttctagctgcttctgctttatatcatttttcctct
tgtgagctgatgcagagggtttcaggttatgaattttctgacatagaggactgtgtgaaa
tggatggttccctttgctatggttatcaaggaagtcggaagcacaacgatgaagcagttc
agaggagttcctgcagaagatctgcacaatatacagacgcacataaacacttttgatttg
ctggacaaagttgaatccaaacaggcctctttggctgagaagagcaggcattcccctttg
ccccctggaatcctcacccctcctcagagtagtaagaaattgcctcagttgtga

KEGG   Anolis carolinensis (green anole): 100563792
Entry
100563792         CDS       T01608                                 

Gene name
ccne2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100563792 (ccne2)
   04114 Oocyte meiosis
    100563792 (ccne2)
   04115 p53 signaling pathway
    100563792 (ccne2)
   04218 Cellular senescence
    100563792 (ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100563792 (ccne2)
   03036 Chromosome and associated proteins [BR:acs03036]
    100563792 (ccne2)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100563792 (ccne2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100563792 (ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100563792
NCBI-ProteinID: XP_003219558
Ensembl: ENSACAG00000003953
UniProt: G1KCG6
LinkDB
Position
4
AA seq 397 aa
MSRRSSRLQAKLHQPCQDTSPQELPASLHNRKRKAMQDPMGKEENSMRHQYEIKSCWPST
ISGGISPCIIIETPHKEATTTDFSRFKQYRFRNLFINPSPLPELSWGSSKDVWLNILKKE
SKYSHCKHFTSLHTNLQPHMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKNIN
KTMLQLIGITTLFIAAKLEEIYAPKLQEFAYVTDGACSEEDIVRMELIVLKALKWELCPE
TIVSWLNLYLQVDAVKDAPKVLLPQYSQEKFIEIAQLLDICILDVNSLDFQYRILAAAAL
CYYTSIVVVNKVTGLEWDSIAECVEWMEPFFRVAKKYPVKLKNFKKIAAEDRHNIQTHIN
YLDMLDEVHYEIEVTGPSQRSPVSTGGIITPPKSSEK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagcagccgtttgcaagctaaactacatcagccttgccaggatacatct
ccacaagaactgccagcatctcttcacaatagaaaaaggaaagcaatgcaagaccccatg
ggaaaggaagaaaacagcatgagacatcaatatgaaattaagagctgttggccctccacg
atatcaggtggcatctccccttgtataataatagaaactcctcacaaagaagcaacaacc
actgacttctccagattcaagcaatacagatttagaaacctcttcataaacccatcgcct
ttaccagaacttagttggggcagttctaaagatgtctggctcaatattctcaaaaaagaa
agcaaatattcgcactgcaagcattttacctctctacacacgaacctgcagccacacatg
agatcaatcttacttgactggcttctggaggtgtgtgaagtatatacgctccacagggaa
actttttacttggcgcaagacttttttgacaggttcatgctgactcaaaaaaacataaac
aaaacaatgcttcagctcataggaattacaacactcttcattgctgccaagcttgaagag
atctatgcacccaaattacaggaatttgcttacgttactgatggtgcttgcagtgaagaa
gatattgtaagaatggaactcattgtactgaaggctctaaagtgggagctgtgtccagaa
acaatagtctcttggttgaacctttatctccaagtggatgcagtcaaagacgctccaaag
gtgctgctacctcagtattctcaggaaaagtttattgaaatagcacagcttttagatatc
tgtattctggatgtcaattctctggatttccagtatagaatattagcagcagctgcactg
tgttattatacctcaatagtagtagtcaataaagttacaggcttggaatgggatagcatt
gcagaatgtgtagaatggatggagccattttttcgggtagcaaaaaaatacccggtgaaa
ttgaagaacttcaagaagattgcagccgaagacagacacaatatacagactcacataaat
tatttggatatgctggatgaagttcattacgaaatagaagttacaggaccaagccagcga
tcgccagtgtctacaggaggaattattactccgccaaagagctctgagaagtga

DBGET integrated database retrieval system