KEGG   Anolis carolinensis (green anole): 100553663Help
Entry
100553663         CDS       T01608                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00052  Galactose metabolism
acs00500  Starch and sucrose metabolism
acs01100  Metabolic pathways
acs04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100553663
   00500 Starch and sucrose metabolism
    100553663
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100553663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100553663
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100553663
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100553663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100553663
NCBI-ProteinID: XP_008116606
Ensembl: ENSACAG00000011273
LinkDB All DBs
Position
Un
AA seq 926 aa AA seqDB search
MKSYQKLTTDSTQVPEAGEDNVDGRPLCHQKLSAWWLGGGLLMVAALLSGVTVWVLGQIW
WSQHGTPPLAKCVSIPEDLRFDCYPERNTVVTQELCEARGCCFVDSEQSSGSTNGVPWCF
YPPDFPSYTLGSVNETELGLVGFLTRKAKAYYPKDIEKLQLSVEFETDTRLHVKITDATS
PRNEVPLEVPPVTKKAEXPIYTVEFSKEPFGLIVKRKTSGTVLLNTTMAPLFFADQFLQI
STLLPSSYLYGLGEHRSNFLHSLEWNTLTFWARDVPPTESFNLYGVHPFYLVMEKTGAAH
GVFLLNSNAMEVALQPAPALTWRTIGGVLDFYIFLGPDPNLVVQQYQQVIGFPAMPPYWG
LGFHLCRWGYGSSNETWETVKAMRNFQIPQDAQWNDIDYMEGYRDFTVDSQKFGALPQMV
EDLHKHGQYYVMILDPGISSTQPPGSYWPYDEGLKRGVFINNTQGEPLIGKVWPGLTAYP
DFSNPDTHQWWLENLNRFHSIVPFDGIWIDMNEPSDFMDGSSEGCSQGKLDNPPYVPAVL
GGFLSAKTICTSSRQSTSAHYNLHNLYGLMEAKATASALIKLREKRPFIISRSTFPSQGK
YSGHWLGDNRSSWKDMAWSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFY
PFSRNHNTQDEKAQDPPAFSPAARTTMKEALEIRYSLLPYLYSLFHRAHLQGDTVARPLF
FEFPKDVATYSIDKQFLWGRGLLVTPVLDPGVDWVVGYFPRGLWYDYYTGSLVNSSGENL
KMAAPLDHINLHIREGTILPTQKPGCCTVISRGNPMRLIAALSQNANAWGDLYWDDGESL
DAFAKGDYSYLVFNVTQNTFTSAVLHSNVEATHVTVDVLTVYGVGEEPKIVTVNGKEWPF
SYLTNQVLTVSDLQLSLSQGFSIQWK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctatcagaagctgaccacagactccacgcaagtcccggaagctggagaggac
aacgtggatgggaggccactgtgccaccaaaagctctctgcctggtggctgggcggaggc
ctcctgatggtggccgctttgcttagcggagtgaccgtttgggtcctgggccagatttgg
tggagtcaacatgggacgcctcccctagccaagtgcgtctccatcccagaagacctccgc
ttcgactgctacccggaaagaaacaccgtggtgacgcaggaactgtgcgaggcccggggg
tgctgtttcgtcgacagcgagcagtcctccggaagcaccaacggggtgccctggtgcttc
taccccccagatttccccagctacaccttggggagcgtgaatgagaccgaactggggctg
gtggggttcctgaccaggaaagcaaaggcctattacccaaaagacattgagaaactgcag
ctcagcgtggagtttgaaaccgatacccggttacacgtcaagatcaccgatgccacatct
cctcggaatgaagttcccttggaagtccctccggtgacaaagaaagcagagnaccccata
tataccgttgagttctccaaggagccctttgggttgatagtgaagcggaaaacttcaggg
acagtgctgttgaacacgacgatggctcccttgttcttcgctgatcagtttctccagatt
tctaccctccttccatcttcgtacctttacggtctgggggagcatcgaagcaacttcctg
cacagcctggagtggaacactttgactttctgggccagagatgttcctccaacggagagc
ttcaatctctatggcgttcatccgttttatcttgtcatggagaagactggagccgcccac
ggggtcttcctcttgaacagcaacgcaatggaggtggcccttcagccggcacctgccctc
acctggaggaccattggaggagttctggatttctacatctttctaggaccagatcccaac
ttggtggtccagcagtaccagcaggtgattggcttcccggccatgcctccttattggggc
ctgggcttccacctctgccgctggggctacgggagcagcaatgaaacctgggagaccgta
aaagccatgaggaatttccagatcccccaggatgcccaatggaacgacattgactacatg
gagggctatcgggacttcactgtggactctcagaagtttggcgctctcccccagatggtg
gaagacctccacaaacacggacaatattacgtgatgattctggatcccgggatcagcagc
actcagcctcctggctcttactggccgtatgatgaaggtttgaaacgtggcgtgttcatc
aataacacccaaggagaacctctaatagggaaggtctggcccggccttactgcttatcct
gacttctctaacccagatactcaccaatggtggctggagaatctgaatcgtttccactcc
attgttcccttcgatggcatttggattgacatgaatgaaccatctgacttcatggatggc
tcatcggaaggctgttctcaaggaaaactggataacccaccatatgtgcctgctgtattg
ggaggtttcctttctgccaagaccatctgcacctcctccaggcaaagcacctctgcgcac
tacaacctccacaacctgtatggattgatggaagccaaagcgactgctagcgctctgatc
aaactcagggagaagcgtcccttcatcatctcccgctcgacttttccaagccagggcaaa
tattcaggacattggcttggtgacaacaggagcagttggaaggacatggcttggtccatc
cctggaatgctgagtttcagcctctttgggatccctttagttggggcggatatctgcggc
ttctctggttctacctctgaggaactctgcactcgctggatgcagctgggcgccttctat
cccttttcccgaaaccacaacactcaagacgagaaggctcaggatcccccggccttcagc
cctgcagcgaggaccaccatgaaggaggccttggaaatccgctacagcttgctgccctat
ctctattctcttttccatcgtgctcatctgcaaggggataccgtggcccggcctctgttt
tttgagtttccaaaggatgtggccacctactccatcgacaagcagttcctctggggacgg
ggtttgttggtgacgccggtgctggaccctggtgtggactgggtggtcggctacttccct
cgaggcttgtggtatgactactacacgggttctctggtgaatagcagtggggaaaacttg
aaaatggcagccccactcgaccacatcaatttgcacatccgtgaagggaccattctccca
acccagaaaccaggttgctgcactgtgattagccgaggtaatcccatgcgcttgatcgca
gccttgtcgcagaacgccaacgcctggggagatctttactgggacgacggcgaaagcttg
gatgcctttgcgaagggcgactattcgtacttagtgttcaacgtcacccagaataccttc
acttctgccgtcctgcattccaatgtggaagccactcatgtcaccgtggatgtactgacg
gtatacggagtgggagaagagccaaagattgtcactgtcaatgggaaggagtggccattc
agctatttgacaaaccaggttctcaccgtgagtgacctacagctcagcctcagccaggga
ttctccatacagtggaagtga

DBGET integrated database retrieval system