KEGG   Anolis carolinensis (green anole): 100553769
Entry
100553769         CDS       T01608                                 

Gene name
rfwd2
Definition
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100553769 (rfwd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100553769 (rfwd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100553769 (rfwd2)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100553769 (rfwd2)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100553769 (rfwd2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100553769 (rfwd2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 Prok-RING_4 zf-RING_4 DZR zf-Nse
Other DBs
NCBI-GeneID: 100553769
NCBI-ProteinID: XP_003219915
Ensembl: ENSACAG00000014695
LinkDB
Position
4
AA seq 719 aa
MSGSRQPPQHSAAGPPPPGSSSPSVTTSASSATAAAAPGASSSSSSASVGLGAPARPVLV
AAAASGSSSSSAGLARLAGGGRAGSGGAGSANSSSSSSRKRPLLTPLCNGLLNSYEDKSN
DFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNEL
ILKQKQRFDEKRFKLDHSVSSTNGHRWQIFQDLLGTDQDNLDLANVNLMLELLVQKKKQL
EAESHAAQLQILIEFLKVARRNKKEQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTV
PQFEAPSPSPSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYF
STRMTRVSDDSRTSSQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRD
CDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYE
GTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASI
EAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEE
IVSASTDSQLKLWNVGKPHCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLS
KTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtcggggagccggcagccgccccagcactccgcggccgggcctcctcccccggggtcc
tcctccccttcggtcaccacctcggcctcttcggccacggctgcggcggctccgggcgca
tcttcttcctcctcttccgcgtcggtgggtctgggggcccccgcgcggcctgtcttggtg
gcggccgccgcctcgggctcttcctccagcagcgcgggcctggctcgcctggcgggggga
ggccgggctgggagcggcggcgcaggcagcgccaatagcagcagtagcagcagcaggaag
aggccgctgctgacgccgctctgcaatggcctcctgaactcctacgaagacaaaagcaac
gacttcgtgtgccctatctgttttgatatgattgaagaagcatacatgacaaaatgtgga
cacagcttttgttataaatgtattcatcaaagcctggaggacaacaatagatgtccaaaa
tgtaattatgttgtggataacattgaccatctttatccaaattttttagtgaatgaactt
attcttaaacagaagcaaagatttgacgaaaagagattcaaactggaccattcagtgagt
agcaccaatggtcacaggtggcagatatttcaagatttgctgggaacagatcaagacaac
cttgatttggccaatgttaacttaatgttagaactcctggtccagaagaaaaaacagctg
gaagcagagtcccatgctgcccagttacagattttgattgaattcctgaaggttgccagg
agaaataaaaaggagcaactggaacagatccagaaagagctgagtgttctggaagaagat
attaaacgggtggaggaaatgagcggcttgtattcacctgtcagtgaagatagcactgtt
cctcagtttgaagctccctcaccttcacccagtagcattattgattctacagaatacagt
cagcctccaggattcagtggcagttcccagactaaaaaacaaccgtggtataatagtacg
ttagcatcaaggcgaaagaggcttacagctcattttgaagatctggagcaatgctatttt
tctaccaggatgactcgagtatcagatgacagcagaacctcaagtcagttggatgaattt
caggagtgcctttccaaattcactcgctacaattctgtccgaccgctggcaacgttgtct
tacgctagtgacctctacaatggatccagtatagtatccagtattgaatttgaccgggat
tgtgactattttgccattgctggagtgaccaagaagattaaagtctatgaatatggcaca
gtcattcaggatgcagttgacattcattaccctgaaaatgaaatgacatgcaattccaaa
atcagctgtatcagctggagtagttaccataaaaatctattggccagcagtgactatgaa
gggaccgtcatcttgtgggatgggttcacagggcagcggtcaaaagtctaccaggagcat
gagaaaagatgctggagtgtagactttaatttgatggatcctaaactcttggcttcaggt
tctgatgatgcaaaagtgaagttgtggtcaaccaacctggacaattcagtagcaagtatt
gaagccaaggcaaatgtgtgctgtgtgaaatttagtccatcatcaaggtatcatctcgca
tttggttgtgcagatcactgtgttcactactatgatcttcggaacactaaacaaccaatt
atggtcttcaaagggcatcgcaaagctgtttcatatgcaaagtttgttagtggagaggaa
atagtatctgcgtcaacagacagtcagctaaagctgtggaacgtagggaagccacactgt
ttgcgttcctttaagggtcatatcaatgagaagaattttgtaggtttggcttctaatgga
gactatattgcctgtggaagtgaaaataattccctctacctgtactacaagggcctctca
aagacactactaaccttcaaattcgatactgtcaaaagtgtcttggataaggaccgtaag
gaggatgatacaaatgaatttgtcagtgctgtgtgctggcgggcactgccagatggggag
tctaatgtgctaattgctgctaacagccaaggtacaattaaggtcctggaattggtatga

DBGET integrated database retrieval system