KEGG   Anolis carolinensis (green anole): 100553901
Entry
100553901         CDS       T01608                                 

Gene name
shisa5
Definition
(RefSeq) shisa family member 5
  KO
K10135  scotin
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100553901 (shisa5)
SSDB
Motif
Pfam: Shisa Prominin
Other DBs
NCBI-GeneID: 100553901
NCBI-ProteinID: XP_003217704
Ensembl: ENSACAG00000008923
LinkDB
Position
2
AA seq 235 aa
MATVASPLLSLCALLFGLLPPGGFCESCETYQDSDGHLYLGTSCTDFCCGSCLNRYCCSD
LSQKLDKYNQLMCNLQLLERTSPPAMGVAMKFESEFRQFPGVTFIVIGVTVFILIVTLIV
VCFTCSCCCLYKACRGQPRPVVTTTTATTVVQVPYPQQPGMATGYPPGVYQGYSPIPVQP
QHGMPAAPYPTQYPPPYVAQPSGPPAYHETMAAGAGAPASQPPYNPAYMDHTKSY
NT seq 708 nt   +upstreamnt  +downstreamnt
atggccaccgtcgccagccctctcctgagcctctgcgccttgctctttgggctgctgcct
cccggcggtttctgtgagagttgtgaaacataccaagattctgatggacatttatatttg
ggaacaagttgtacagatttttgctgcggaagctgcctcaaccgatattgctgctcagac
ttgtcgcaaaaattggataaatataaccagcttatgtgtaatttgcagctgttggaaagg
acatctccaccagccatgggagtggcgatgaaattcgaatcagaattcagacaattccct
ggtgtcacttttatagtaatcggagttacagttttcatcctgattgtaacccttattgtt
gtctgcttcacatgctcatgttgctgcctgtacaaagcatgccgagggcaaccacggcct
gttgtgaccacaactacagccactactgtggtgcaagtgccataccctcagcagcctggt
atggccacaggttacccaccaggtgtgtaccaaggatatagtcctatcccggtgcagccg
cagcatgggatgcctgccgctccctacccaacccagtaccctccaccttacgtcgcacag
ccttcaggaccaccagcatatcatgaaacaatggcagctggtgctggagctcctgcaagt
cagccaccttataaccctgcatatatggatcacacaaagtcatactga

DBGET integrated database retrieval system