KEGG   Anolis carolinensis (green anole): 100553987
Entry
100553987         CDS       T01608                                 

Gene name
actn1
Definition
(RefSeq) actinin alpha 1
  KO
K05699  actinin alpha 1/4
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100553987 (actn1)
   04520 Adherens junction
    100553987 (actn1)
   04530 Tight junction
    100553987 (actn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100553987 (actn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100553987 (actn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100553987 (actn1)
   04147 Exosome [BR:acs04147]
    100553987 (actn1)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100553987 (actn1)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100553987 (actn1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100553987 (actn1)
  Exosomal proteins of colorectal cancer cells
   100553987 (actn1)
  Exosomal proteins of bladder cancer cells
   100553987 (actn1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_8 EF-hand_5 XisI Uds1
Other DBs
NCBI-GeneID: 100553987
NCBI-ProteinID: XP_003224902
Ensembl: ENSACAG00000005395
UniProt: H9GAA9
LinkDB
Position
Un
AA seq 893 aa
MMDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDF
RDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGN
AKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGF
CALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIM
TYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLEN
RVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGK
MVSDINNAWGCLEQAEKGFEEWLLNDIRRLERLDHLAEKFRQKACIHESWTEGKEAMLQQ
KDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKI
CDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVH
TIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTINPQE
INSKWDHVRQLVPRRDQALMEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE
MHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQ
LLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLG
YDIGNDAQGEAEFARIMSIVDPNRIGVVTFQAFIDFMSRETADTDTADQVMASFKILAGD
KNYITVDELRRELPPDQAEYCIARMAPYTGLDSVPGALDYMSFSTALYGESDL
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgatggatcattacgactcgcagcaaaccaacgactacatgcagcccgaggaagactgg
gacagggatctccttttggatccagcctgggagaagcagcagaggaagacgtttacagcc
tggtgtaattctcacctccgaaaagcaggcacacagattgagaacatagaggaagatttc
agggatggccttaaacttatgttgctcctcgaagtcatatcaggtgaacgtttggctaaa
ccagaaagaggcaaaatgagagtgcataaaatctcgaatgtgaacaaagccttagacttc
attgctagcaaaggagtcaagctggtctccattggagcagaagaaattgttgatgggaat
gcaaaaatgactcttggaatgatctggaccatcattctccgttttgccattcaggacatc
tcagtagaagaaacatccgctaaagaagggcttttgttatggtgtcagcggaagacagca
ccatacaaaaatgtgaacattcaaaacttccatattagctggaaggatggccttggtttt
tgtgccttgattcacagacatcgtccagagctcattgactatgggaagctaagaaaggat
gatcctctcactaacttgaatacagcttttgatgtggctgaaaggttcctagatatcccc
aagatgttggatgcagaagacattgttggaacagcccgtcctgacgagaaggccatcatg
acctatgtttctagcttctaccacgccttctcaggagcccagaaggcggaaacagcagcc
aatcgtatctgcaaggtgctggcagttaatcaagaaaatgagcaactaatggaagattac
gagaagttggccagtgatctgttagagtggatccgtcgcaccattccttggctggagaat
cgggtaccagagaacaccatgcaagccatgcagcaaaaactagaggatttccgggattac
cgccgccttcacaagcctcccaaagtccaggagaagtgccagctggaaatcaacttcaac
accctgcaaactaagctgcgacttagcaacaggcctgcctttatgccttctgaagggaaa
atggtctcggatataaataatgcatggggttgcctggaacaggctgagaagggctttgaa
gaatggcttttgaatgacattagaagactagaacggctggatcacctggcggagaagttc
cggcaaaaagcttgcattcatgaatcttggacagaaggtaaagaggccatgttgcagcag
aaagactacgaaactgccacactctcagagatcaaggccctgctaaagaaacacgaggca
tttgagagcgacctcgctgctcaccaggaccgtgtggaacagattgctgctattgcacaa
gaactcaatgagttggattattatgattcaccaagtgtcaatgccagatgtcagaaaata
tgtgaccagtgggataaccttggggctctgacccagaaacgacgagaagcattggagaga
acagaaaaactcctggagacgattgaccagttgtacctagaatatgccaagcgtgcagcc
cctttcaataactggatggagggggccatggaggatcttcaggacaccttcatagtccat
accattgaggagatccagggattgaccacagctcacgaacagttcaaagcaaccttgcca
gatgctgacaaggagcgacaggccatcctaggaatccataatgaagtgtcgaaaattgtc
cagacctaccacgtcaacatggcaggaaccaacccctacaccaccatcaatccacaagaa
atcaacagcaaatgggaccatgtgaggcaactagttcccaggcgggatcaagcgctcatg
gaagaacacgcacgccagcagcataatgagagactccgcaaacagtttggggctcaagcc
aatgtaattgggccctggatccaaaccaagatggaggagattggccgtatctccatagag
atgcatgggacactggaggaccagctcaatcacctgcggcagtatgaaaaaagcattgtg
aactacaaaccaaagattgatcagctggagggagatcaccaacagatccaggaagcactc
atctttgataataagcacaccaactacaccatggagcacatccgagtgggctgggagcag
ctcctcacaacaatagctagaactattaatgaggtggaaaaccagattctaactcgagat
gccaaaggaatcagccaggaacagatgaatgaattccgtgcctctttcaaccactttgac
agggaccactccggcacacttggccccgaggaattcaaagcctgcctcatcagcttgggt
tacgatattggaaacgatgcacagggagaagctgaatttgcccggatcatgagcattgta
gaccccaatcgcataggagtagtgactttccaggccttcattgacttcatgtcccgggaa
acagcagatactgatacagctgaccaggttatggcctcattcaaaatcctggctggagat
aaaaattatatcactgtggatgaattacgacgggagctgcctcctgatcaagccgaatat
tgtattgctagaatggcaccttacaccgggctggattccgtgcctggtgccctggactat
atgtctttctccacagccctttatggcgaaagtgacctttaa

KEGG   Anolis carolinensis (green anole): 100566396
Entry
100566396         CDS       T01608                                 

Gene name
actn4
Definition
(RefSeq) actinin alpha 4
  KO
K05699  actinin alpha 1/4
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100566396 (actn4)
   04520 Adherens junction
    100566396 (actn4)
   04530 Tight junction
    100566396 (actn4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100566396 (actn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100566396 (actn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acs04812]
    100566396 (actn4)
   04147 Exosome [BR:acs04147]
    100566396 (actn4)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100566396 (actn4)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100566396 (actn4)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100566396 (actn4)
  Exosomal proteins of colorectal cancer cells
   100566396 (actn4)
  Exosomal proteins of bladder cancer cells
   100566396 (actn4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8 XisI
Other DBs
NCBI-GeneID: 100566396
NCBI-ProteinID: XP_003228575
Ensembl: ENSACAG00000010046
LinkDB
Position
Un
AA seq 905 aa
MVDYHAAGQPASYQYGGNGPGIGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRK
AGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKL
VSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQ
NFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDI
VNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLL
EWIQRTIPWLENRVPQKTMQGMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRL
SNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNEMRRLERLEHLGQKFRQKASIHE
SWTEGKEAMLKQKDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYY
DSPSVNARCQKICDQWDTLGSLTHTRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMES
AMEDLQDMFIVHTIEEIEGLIAAHDQFKSTLPDADKEREAILGIQSEAQKIADYNNIKLS
GNNPYTSVTPQIINSKWERVQQLVPKRDHALQDEQSKQQSNEHLRRQFASQANIVGPWIQ
TKMEEIGRISIEMNGTLEDQLNHLKQYEQSIVDYKPNIDVLEQQHQLIQEALIFDNKHTN
YTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGSLG
PEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNNSGVVTFQAFIDFMSRETTDTDTAD
QVIASFKVLAGDKNYITAEELRRELPPDQAEYCIARMAPYQGPDAIPGALDYKSFSTALY
GESDL
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggtggattaccacgccgccggacaaccagcttcttatcagtacggcggcaacgggccc
ggcatcggggactacatggctcaagaggacgactgggaccgggacctcctgctcgacccc
gcctgggagaagcagcagcgcaagactttcacagcatggtgcaattcccacctgcggaaa
gccggtacacagattgagaacattgacgaagatttccgcgatggcctcaagctcatgtta
ctcctcgaggtgatttcaggagaacggttaccaaaaccagagagaggaaagatgagggtg
cacaagatcaacaacgtcaacaaagccctcgattttatcgcaagcaaaggagtcaaactg
gtttccataggagctgaagaaattgtcgatggcaatgcaaagatgaccctcggtatgatc
tggacgatcatcctcagatttgccattcaggatatctccgtggaagaaacctcggccaag
gagggcctgttgctctggtgccagaggaagacggctccctacaagaacgtgaacgtgcag
aacttccacataagctggaaggatggccttgcttttaatgccttgatccacagacacaga
ccagaactcattgaatacgacaagctcagaaaggacgatcccgtgacaaatctgaacaat
gcctttgaggtcgccgagaaataccttgacattcccaagatgctggatgcggaagatatt
gtcaacacagctcgtcccgatgagaaggccattatgacctatgtctccagcttctatcat
gccttctctggcgcacagaaggccgagacagctgcaaacaggatttgcaaagtgttggcg
gtgaaccaggaaaacgagcacctgatggaagactacgagaagctggcttctgatcttctg
gagtggattcagcgcaccatcccttggctggagaaccgcgtccctcagaagactatgcaa
gggatgcagcagaagctggaggatttccgtgactaccggagggtccacaagcctcccaag
gtgcaggagaagtgccagctggagatcaacttcaacaccttgcagaccaagctgcggctg
agcaatcggccggctttcatgccttctgaggggaagatggtttcggatatcaacaatggt
tggcagcacttggagcaggcggagaagggtttcgaagagtggctactgaatgagatgcgg
aggctggagcggctggagcacttgggtcagaagttcaggcagaaggcatccattcacgag
tcttggactgaaggcaaagaggccatgctgaaacagaaggactacgagacggccaccctt
tcggacatcaaagccctgatccggaaacacgaggcttttgagagcgacctggcggctcat
caggaccgagtggagcagattgcggccattgctcaggagctcaatgagctggactactat
gactccccgagtgtcaacgcccgttgccagaagatctgtgaccagtgggacacgctagga
tccttgactcacacacggagggaagctctggagaaaacagagaagcagctggagaccatc
gaccagctccacttggagtatgccaagcgggcagcgcccttcaacaactggatggagagc
gccatggaggacctgcaagacatgttcattgtccacaccattgaggagattgagggcctg
attgcagcccacgaccagttcaagtccaccctgcctgatgcagacaaagagcgggaagct
atcctgggcatccagagcgaagcacaaaagattgcggattacaataacataaaactctcc
gggaacaacccgtacacttcggtcactccacagatcatcaactccaagtgggaaagggtg
cagcaattggtgccaaagagggaccatgccttgcaagatgagcagagcaagcaacagtcc
aatgaacacttgcgtcgacagtttgccagccaggccaacattgtggggccctggatccag
actaaaatggaggagattgggcgcatttccatcgaaatgaacggcaccttggaagaccag
ctgaaccacctcaagcagtacgagcagagcatcgttgattacaagcccaacattgacgtc
ctggagcagcagcaccaactcatccaggaggccctcatctttgacaacaagcacaccaac
tacaccatggagcacattcgtgtagggtgggagcagctcctcaccaccattgcccggacc
atcaatgaggtggagaaccagatcctgacccgggacgcaaagggaatcagccaggagcag
atgcaagagttccgggcctccttcaaccactttgataaggaccatggcggctccctcgga
ccagaagagttcaaagcctgcctcatcagcttgggatacgatgtggaaaatgacagacag
ggagatgccgagttcaacaggatcatgagcgttgtggatcccaacaacagtggcgttgtc
accttccaagccttcattgacttcatgtcccgggagacgacagacacggatacggctgac
caagtcattgcttccttcaaagtcttagctggtgacaagaactacatcacggccgaggag
ctgcgacgagagcttcctcccgaccaggccgagtactgcatcgcccgcatggcaccttac
cagggacccgacgccatccccggggcccttgactacaagtccttctccacagctctgtat
ggcgagagcgacctgtga

DBGET integrated database retrieval system