KEGG   Anolis carolinensis (green anole): 100554137
Entry
100554137         CDS       T01608                                 

Gene name
tp73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100554137 (tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100554137 (tp73)
Transcription factors [BR:acs03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100554137 (tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 100554137
NCBI-ProteinID: XP_008122218
Ensembl: ENSACAG00000001622
UniProt: H9G5L7
LinkDB
Position
Un
AA seq 633 aa
MSRSSPADEGTTFEHLWSTLEPDSTYFDLPQSGPRTGSETPNRTEVTMDVFQMRSMNTSV
MSQFNLLNGSMDQSTDSRAASSSPYNSEHASNVPTLSPYSQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSGPPPPGTIIRAMPV
YKKAEHVTEVVKRCPNHELGRDFNDGLSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESAAKNGNPNKRTFKQSPQGMPALGAGMKKRRHGEEETYYVPVR
GRENFEILMKIKESMELVELVPQQLVDSYRQQQQQLLQRQTHLQPPSSYGPVLSPMNKLH
AGGVNKLPSVNQLVGQPQQHGPNTGPNLGPMGPGILNSHPMQSNGDMNGGHSSQSMVSGA
HCSPPPPYNPDPSLVSFLTGLGCSNCIDYFTSQGLQTLYQLQNLTLEDLVLLKIPEQYRM
IIWRGLQDLKQGHDYGAQQLIRSSGNASTISIGASGELQRQRVMEAVHFRVRHTITIPNR
GGADEWADFGFDLPDCKSRKHSIKEEFTEGEIN
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgtcccggtcctccccagcggatgaaggcaccacctttgagcatctctggagcaccctg
gagccggacagcacttacttcgaccttccgcaatcgggacccagaacgggcagcgagacc
ccgaaccggaccgaagtcacgatggacgttttccagatgaggagcatgaacacttcagtc
atgtcccagttcaatttgctcaacggcagcatggatcagagcactgacagtcgagctgcc
tcgtcgagcccgtacaactcggagcacgcctccaatgtcccgacgctctcgccgtactcc
cagcccagctccaccttcgacaccatgtccccggcgcccgtcatcccctccaacaccgac
tacccgggaccgcaccacttcgaggtcaccttccagcagtccagcaccgccaaatccgcc
acctggacgtattccccgctgctgaagaagctctactgtcagatcgccaagacatgcccc
atccagatcaaagtgtccggccctcctccgccggggaccatcatccgcgccatgcctgtc
tacaagaaggccgagcacgtgacggaagtggtcaaacggtgcccgaaccacgaacttggg
cgtgacttcaatgacggtctctcggctccagccagccacctcatccgtgtggaaggcaac
aacctctcccagtatgtggacgacccagtgactgggaggcagagcgtcatggttccgtat
gagcctccacaggtgggcaccgaattcaccaccatcctctacaatttcatgtgcaacagc
agctgcgtcggcggaatgaaccggcgtcccatcctcatcatcatcacgctggaaacgcga
gatgggcaggttttggggcggaggtcgttcgaaggccggatctgtgcttgccctggcagg
gaccggaaagcggacgaggaccattatcgggagcagcaagccctgaacgaaagcgcggcc
aaaaacggcaaccccaacaagcggacgttcaagcaaagtccgcaagggatgccagcactg
ggagctggaatgaagaagcggaggcacggagaagaggaaacatactacgttcccgttcgg
ggccgggagaatttcgagatactgatgaagatcaaggagagcatggagctggtggagctg
gtgccccagcagttggtggactcctatcggcagcaacaacagcaactccttcagcgccag
actcacctgcagcctccgtcttcgtacggtccggtcctgtccccgatgaacaagctccac
gcaggaggggtcaacaaactgccatcggtgaaccagttagtcggccagccgcaacagcac
ggccccaacaccgggccaaatctggggcctatggggccaggaatactgaacagccacccc
atgcagtccaacggcgacatgaacggcggccactcctcgcagtccatggtctccggggcg
cactgcagcccccctccgccctacaacccggatccaagccttgtcagttttttaacagga
ttggggtgctccaactgcatcgactacttcacctcacaagggttgcagaccctttaccag
ctgcagaatctaaccctagaggaccttgttcttctgaagatccccgagcaataccggatg
atcatctggaggggcctccaggacctgaagcagggccacgactacggcgcccagcagctc
atccgctccagcggcaacgcctccaccatctccatcggcgcgtcgggggagctgcagcgg
cagcgcgtcatggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgc
ggcggggcagacgagtgggcggactttggcttcgacctcccggactgcaagtcccgcaag
cactccatcaaagaggagttcacggagggggaaatcaactga

DBGET integrated database retrieval system