KEGG   Anolis carolinensis (green anole): 100554161Help
Entry
100554161         CDS       T01608                                 

Gene name
cndp1
Definition
(RefSeq) carnosine dipeptidase 1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00330  Arginine and proline metabolism
acs00340  Histidine metabolism
acs00410  beta-Alanine metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100554161 (cndp1)
   00340 Histidine metabolism
    100554161 (cndp1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100554161 (cndp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100554161 (cndp1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     100554161 (cndp1)
Peptidases and inhibitors [BR:acs01002]
 Metallo peptidases
  Family M20
   100554161 (cndp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 100554161
NCBI-ProteinID: XP_008106947
Ensembl: ENSACAG00000003637
UniProt: G1KC31
LinkDB All DBs
Position
4
AA seq 510 aa AA seqDB search
MIFCISLIMLLLAGGNSSSPNSLSQEEERIFQYIDGHQDEFVQNLAGWVAVESDSIQPHL
RAEVTRMVKIAAASLQDLGASVMLRDTGIQQLPSGQNISLPPVILAKLGEDPLKPTVCFY
GHVDVMPAKIQDGWKTSPYNLTEIDGNLFGRGTTDDKGPVLAWINAVKTFKALNIEIPVN
IKFLIEGMEEAGSIGLEELVEKEKEHFFSDVNYIVISDNIWLSTTKPALTYGTRGNACFS
VQVECGEKDLHSGSVGGIVHEAMSDLIALLDSLVNSCGHILVPGIYDDVAPLTEEEKKQY
ELIEFDLKEYKASIGVKEIIYDTKEEIFSHLWCLPSLSIHGIEGAFYEPGIKTVIPSRVI
GKFSIRQVPHMDLSKMECQVKRYLERIFSKRKSSNKLTVSMEMGAKPWVANINDPQYEAA
KKAIQKVFNQDPDMIRDGATIPIARMFQDITKKSVMMFPIGAADDGEHSQKEKISRSNYI
NGIKVFASFLLEISKLHKTLQEAPSLKTMT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatattctgtatttccctcatcatgctgctccttgctggaggcaactcgtcatcccca
aattccttatcacaggaggaggagcggatttttcagtacattgatggccatcaagatgaa
tttgttcagaaccttgcaggatgggtggctgtggagagtgattccatacaaccacatcta
cgagcagaagtaacacgaatggtgaagatcgctgcagccagccttcaagacttaggagca
agtgtaatgctccgtgacactggcattcaacagctacccagcggccagaatatttcttta
cctcctgttattctagcaaagcttggggaagatcccctaaagccaactgtgtgcttttat
ggtcatgtggatgtgatgcctgccaaaatccaagatggatggaaaacctctccctacaac
ctgactgaaattgatggaaacctttttggacggggaacaacagatgacaaaggacctgtc
ctagcctggataaatgcagtgaagacctttaaagcactgaacatagaaataccagtaaac
atcaaatttctgattgaaggcatggaagaagcagggtccattggcctagaagaactagtt
gaaaaggaaaaggaacattttttctccgatgtcaactatattgtgatctcagacaatatt
tggctcagcacaacaaagccagctcttacgtatgggactcgggggaatgcctgcttctct
gtgcaggttgaatgtggcgaaaaagatcttcattctggaagtgttggtggcattgtccat
gaagccatgtctgatttgatagccttgcttgacagtcttgtgaattcatgtggtcacatt
ctggtccctggaatctatgatgatgttgctccacttacagaagaggaaaaaaagcagtat
gagttgatagaatttgacttgaaggaatacaaagctagcattggtgtaaaggaaattatc
tatgataccaaggaggagattttctcacacttgtggtgtcttccatcactttctattcat
gggatcgaaggggctttttatgaaccagggatcaaaacagtgattccatcaagagtcata
ggaaaattttccatccgccaagttcctcacatggacctttctaaaatggaatgccaggtg
aaaaggtacttagagaggatattctctaaacggaaaagctcaaataaactgacagtgtcg
atggaaatgggtgcaaaaccatgggttgctaatattaatgaccctcagtatgaagctgct
aaaaaggcaatacaaaaagtttttaatcaggatccagatatgatccgggatggtgcaaca
attcctattgccagaatgtttcaggatattacaaagaaaagtgtgatgatgtttcccatt
ggagctgcggatgatggagagcactcccaaaaggagaagataagcaggtctaactacatt
aatggaataaaggtgtttgcctcctttttactggagatttcaaagctccacaagacgcta
caggaagctcccagtttgaagacaatgacatga

DBGET integrated database retrieval system