KEGG   Anolis carolinensis (green anole): 100554400
Entry
100554400         CDS       T01608                                 

Gene name
ddb2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03420  Nucleotide excision repair
acs04115  p53 signaling pathway
acs04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100554400 (ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100554400 (ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100554400 (ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100554400 (ddb2)
   03400 DNA repair and recombination proteins [BR:acs03400]
    100554400 (ddb2)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100554400 (ddb2)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100554400 (ddb2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 100554400
NCBI-ProteinID: XP_003214666
Ensembl: ENSACAG00000003132
LinkDB
Position
1
AA seq 545 aa
MKLPRRRAFPAPLRETQTPEKEKEEEEAAVECLSIMAPGKDSKDKKHLRTCESTSEKEIK
SNRKRKRDCGDLENEPQTKKLNVRKAPKSLDKAGKSFSCSMIRNRGVFSHQLEMQKNIVH
YIYQNMLGSTIRAQLKKCLQVPFVRSLHSYCLFRTASPFNRRITCLEWHPTHPSTVAVGS
KGGDIILWDYEVLNKTCFIEGMGAGGAITGMKFNPFNPSELYTSSVAGTTALQDFNGNTV
RIFTNTNDWDFWYCSVDVSATCRTVVTGDNVGNAILLSTDGEKIWDLKLHKKKVTHVEFN
SRCDWLLATASVDQTVKIWDLRNIKDKSSCLHVLPHDRAVNAAYFSPTDGAKLLTTDQHS
EIRVYSSSDWSKPQHLISHPHRQFQHLTPIKATWHPRYDLIVAGRYPDPLFPGYTADELR
TIDIFDGNSGEMVCQLHDSNALGIISLNKFNPMGDTLASGMGFNILIWSREEMVTKKQER
LMQAMTEQGIGCRNVSRQGGRRQRPSNPGTSKLKTKLLSLELESSKTQTKERKLQEKKKR
KNTED
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgaaactcccgaggaggcgcgcctttcccgcgcctttgagggaaacacaaacgcctgag
aaggagaaggaggaggaggaggccgcggttgagtgtttgagcataatggcccctggaaaa
gattcaaaagacaagaagcatctcaggacatgtgagagtacatcagaaaaagagataaaa
tcaaataggaaaagaaaacgtgactgtggagatctagaaaatgagccacaaacaaaaaaa
ctaaatgtgaggaaagctcccaagagtctggacaaagctggaaaatctttcagttgctcc
atgatccgaaacagaggcgtgttctcccatcagctggaaatgcagaaaaacattgtccat
tatatttatcagaacatgctgggaagcactatcagggcacagctgaaaaagtgccttcag
gtgccgtttgtacgttctctccattcatattgcctgtttcgaacagcaagtcctttcaat
agaagaattacatgtctggaatggcatccaacacaccccagcacagttgctgtgggctcc
aaaggtggagacatcatcctgtgggactatgaagtgcttaataaaacctgcttcatagaa
ggaatgggagctggaggggccatcacaggaatgaagtttaatccttttaatcctagtgag
ctgtacacatcatcagttgctggaactactgccctccaggattttaatggaaatacagtc
cgaatcttcaccaataccaacgactgggatttctggtactgcagtgttgatgtatctgca
acatgccggactgtggtgacaggtgataacgtgggcaatgccatcctgctcagtactgat
ggtgaaaagatatgggatctgaaactgcacaaaaagaaagtgactcatgtggaatttaat
tctcgctgtgattggctcctggctacagcttcagtggatcagacagttaaaatctgggat
ctaagaaacataaaggacaaatcaagttgtcttcatgtacttccacatgacagagcagtc
aatgcagcgtatttcagcccaactgatggtgctaagctactgactactgaccagcacagt
gaaatccgggtttattcatcttctgattggtccaaaccacagcatttgatttcacatccc
catcgccagttccagcaccttacacctatcaaggcaacatggcatcctcgttatgacctc
attgtggctggtcgttacccagaccctcttttcccaggatacacagcagatgagctgaga
actattgacatatttgatgggaacagtggagagatggtgtgccagctccatgattcaaat
gcgttgggcattatctcactcaacaagtttaaccctatgggagacacactggcctctgga
atgggcttcaatattcttatctggagccgtgaggagatggtgaccaaaaagcaggagcgt
ctcatgcaggctatgacagagcaaggaattggatgcagaaatgtatctcgacaaggagga
agaagacagaggccgtcaaacccaggaacaagcaaacttaaaactaaactactcagtctt
gaattagagagctctaaaactcagaccaaagaacgcaaattacaagagaaaaagaaaagg
aagaatacagaggactaa

DBGET integrated database retrieval system